Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relE-higA/HigB-HigA |
Location | 365316..365956 | Replicon | chromosome |
Accession | NZ_CP101910 | ||
Organism | Pseudomonas putida strain ATCC 12633 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | NP430_RS01530 | Protein ID | WP_231859021.1 |
Coordinates | 365316..365441 (+) | Length | 42 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NP430_RS01535 | Protein ID | WP_016497583.1 |
Coordinates | 365483..365956 (+) | Length | 158 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NP430_RS01515 (NP430_01515) | 361483..362205 | - | 723 | WP_016497580.1 | response regulator | - |
NP430_RS01520 (NP430_01520) | 362346..364643 | + | 2298 | WP_016497581.1 | TonB-dependent siderophore receptor | - |
NP430_RS01525 (NP430_01525) | 364935..365141 | - | 207 | WP_016497582.1 | DUF3079 domain-containing protein | - |
NP430_RS01530 (NP430_01530) | 365316..365441 | + | 126 | WP_231859021.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
NP430_RS01535 (NP430_01535) | 365483..365956 | + | 474 | WP_016497583.1 | transcriptional regulator | Antitoxin |
NP430_RS01540 (NP430_01540) | 366366..367664 | + | 1299 | WP_016497584.1 | hypothetical protein | - |
NP430_RS01545 (NP430_01545) | 367668..368246 | + | 579 | WP_016497585.1 | hypothetical protein | - |
NP430_RS01550 (NP430_01550) | 368448..369221 | - | 774 | WP_016497586.1 | FAD-dependent thymidylate synthase | - |
NP430_RS01555 (NP430_01555) | 369218..370108 | - | 891 | WP_041167494.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4864.70 Da Isoelectric Point: 9.8495
>T252879 WP_231859021.1 NZ_CP101910:365316-365441 [Pseudomonas putida]
MRVKKNECRHIACLNARTGTLYIKAILSHAEYDKWCRSDIR
MRVKKNECRHIACLNARTGTLYIKAILSHAEYDKWCRSDIR
Download Length: 126 bp
Antitoxin
Download Length: 158 a.a. Molecular weight: 17170.65 Da Isoelectric Point: 4.6719
>AT252879 WP_016497583.1 NZ_CP101910:365483-365956 [Pseudomonas putida]
MKRAKIEANGLDAFIANISPMLDGLNTQMATMAQLLAACHDPIKDDAELQARMALIDELYSHADSEGHAAARFAEMVADR
VYEYESESVLVPFASQAEALAFLLSDRGVKQKDLSAIATQSAVSEILNNKRKMTVAQVKGFAEFFSVPVEFFMHGVV
MKRAKIEANGLDAFIANISPMLDGLNTQMATMAQLLAACHDPIKDDAELQARMALIDELYSHADSEGHAAARFAEMVADR
VYEYESESVLVPFASQAEALAFLLSDRGVKQKDLSAIATQSAVSEILNNKRKMTVAQVKGFAEFFSVPVEFFMHGVV
Download Length: 474 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|