Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 3962115..3962740 | Replicon | chromosome |
| Accession | NZ_CP101907 | ||
| Organism | Salmonella enterica subsp. enterica strain QA-1986 973 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | NP441_RS19495 | Protein ID | WP_000911337.1 |
| Coordinates | 3962342..3962740 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | C0PXM4 |
| Locus tag | NP441_RS19490 | Protein ID | WP_000557545.1 |
| Coordinates | 3962115..3962342 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NP441_RS19460 (3957178) | 3957178..3958276 | + | 1099 | WP_010989230.1 | peptide chain release factor 2 | - |
| NP441_RS19465 (3958286) | 3958286..3959803 | + | 1518 | WP_000003339.1 | lysine--tRNA ligase | - |
| NP441_RS19470 (3959879) | 3959879..3960424 | - | 546 | WP_050067887.1 | isopentenyl-diphosphate Delta-isomerase | - |
| NP441_RS19475 (3960689) | 3960689..3961447 | + | 759 | WP_077947050.1 | amidase activator ActS | - |
| NP441_RS19485 (3961693) | 3961693..3961906 | - | 214 | Protein_3792 | hypothetical protein | - |
| NP441_RS19490 (3962115) | 3962115..3962342 | + | 228 | WP_000557545.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| NP441_RS19495 (3962342) | 3962342..3962740 | + | 399 | WP_000911337.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
| NP441_RS19500 (3963541) | 3963541..3964077 | + | 537 | WP_058652987.1 | STM3031 family outer membrane protein | - |
| NP441_RS19505 (3964124) | 3964124..3964756 | + | 633 | WP_000835265.1 | YfdX family protein | - |
| NP441_RS19510 (3965475) | 3965475..3966059 | + | 585 | WP_001244638.1 | fimbrial protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 3962115..3970531 | 8416 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15037.43 Da Isoelectric Point: 7.7785
>T252876 WP_000911337.1 NZ_CP101907:3962342-3962740 [Salmonella enterica subsp. enterica]
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHARSRGLVVVTNNLREFERIPGIRIEDWC
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHARSRGLVVVTNNLREFERIPGIRIEDWC
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|