Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 2534701..2535482 | Replicon | chromosome |
Accession | NZ_CP101907 | ||
Organism | Salmonella enterica subsp. enterica strain QA-1986 973 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | A0A3G3E5T9 |
Locus tag | NP441_RS12505 | Protein ID | WP_000625911.1 |
Coordinates | 2534701..2535192 (-) | Length | 164 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | V7IUD2 |
Locus tag | NP441_RS12510 | Protein ID | WP_001271379.1 |
Coordinates | 2535189..2535482 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NP441_RS12480 (2531581) | 2531581..2532411 | - | 831 | WP_023221225.1 | fimbria/pilus periplasmic chaperone | - |
NP441_RS12485 (2532613) | 2532613..2532825 | - | 213 | WP_001293880.1 | PapB/FocB family fimbrial expression transcriptional regulator | - |
NP441_RS12490 (2533451) | 2533451..2533594 | + | 144 | Protein_2439 | transposase | - |
NP441_RS12495 (2533611) | 2533611..2533957 | + | 347 | Protein_2440 | Rpn family recombination-promoting nuclease/putative transposase | - |
NP441_RS12500 (2534238) | 2534238..2534486 | - | 249 | Protein_2441 | IS481 family transposase | - |
NP441_RS12505 (2534701) | 2534701..2535192 | - | 492 | WP_000625911.1 | GNAT family N-acetyltransferase | Toxin |
NP441_RS12510 (2535189) | 2535189..2535482 | - | 294 | WP_001271379.1 | DUF1778 domain-containing protein | Antitoxin |
NP441_RS12515 (2535800) | 2535800..2536022 | + | 223 | Protein_2444 | hypothetical protein | - |
NP441_RS12520 (2536288) | 2536288..2537163 | + | 876 | WP_058653569.1 | AraC family transcriptional regulator | - |
NP441_RS12525 (2537160) | 2537160..2537447 | + | 288 | WP_001269916.1 | transcriptional regulator RtsB | - |
NP441_RS12530 (2537440) | 2537440..2537622 | - | 183 | WP_071591272.1 | ATP-binding cassette domain-containing protein | - |
NP441_RS12535 (2537642) | 2537642..2537741 | + | 100 | Protein_2448 | hypothetical protein | - |
NP441_RS12540 (2537849) | 2537849..2537983 | + | 135 | Protein_2449 | hypothetical protein | - |
NP441_RS12545 (2538278) | 2538278..2539183 | - | 906 | WP_058653032.1 | YjiK family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2524093..2537447 | 13354 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17663.44 Da Isoelectric Point: 7.2655
>T252870 WP_000625911.1 NZ_CP101907:c2535192-2534701 [Salmonella enterica subsp. enterica]
MISSPEPLHAGHILTPFCCGVDSMDNWLKQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTAPGRFRRNMPDP
IPIVVLGRLAVDKSLHGQGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFEPSPMDPMMLMVTLGDLV
ESV
MISSPEPLHAGHILTPFCCGVDSMDNWLKQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTAPGRFRRNMPDP
IPIVVLGRLAVDKSLHGQGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFEPSPMDPMMLMVTLGDLV
ESV
Download Length: 492 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3G3E5T9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V7IUD2 |