Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 2397069..2397585 | Replicon | chromosome |
| Accession | NZ_CP101907 | ||
| Organism | Salmonella enterica subsp. enterica strain QA-1986 973 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A7U1KST9 |
| Locus tag | NP441_RS11785 | Protein ID | WP_000220585.1 |
| Coordinates | 2397069..2397353 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A7U1KSR8 |
| Locus tag | NP441_RS11790 | Protein ID | WP_000212721.1 |
| Coordinates | 2397343..2397585 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NP441_RS11770 (2392185) | 2392185..2393837 | + | 1653 | WP_023993572.1 | alpha,alpha-phosphotrehalase | - |
| NP441_RS11775 (2394246) | 2394246..2396384 | + | 2139 | WP_000187818.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| NP441_RS11780 (2396601) | 2396601..2397065 | + | 465 | WP_001009173.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| NP441_RS11785 (2397069) | 2397069..2397353 | - | 285 | WP_000220585.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NP441_RS11790 (2397343) | 2397343..2397585 | - | 243 | WP_000212721.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| NP441_RS11795 (2397663) | 2397663..2399576 | - | 1914 | WP_001212145.1 | BglG family transcription antiterminator | - |
| NP441_RS11800 (2399593) | 2399593..2400333 | - | 741 | WP_023229489.1 | KDGP aldolase family protein | - |
| NP441_RS11805 (2400330) | 2400330..2401448 | - | 1119 | WP_023256352.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
| NP441_RS11810 (2401432) | 2401432..2402565 | - | 1134 | WP_023257225.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10878.69 Da Isoelectric Point: 9.8739
>T252869 WP_000220585.1 NZ_CP101907:c2397353-2397069 [Salmonella enterica subsp. enterica]
MTYELEIDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNDLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
MTYELEIDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNDLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U1KST9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U1KSR8 |