Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 2355090..2355640 | Replicon | chromosome |
Accession | NZ_CP101907 | ||
Organism | Salmonella enterica subsp. enterica strain QA-1986 973 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | M7RJ32 |
Locus tag | NP441_RS11570 | Protein ID | WP_001199743.1 |
Coordinates | 2355090..2355398 (-) | Length | 103 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | M7RP97 |
Locus tag | NP441_RS11575 | Protein ID | WP_001118105.1 |
Coordinates | 2355401..2355640 (-) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NP441_RS11555 (2353114) | 2353114..2353893 | - | 780 | WP_058653113.1 | HNH endonuclease | - |
NP441_RS11560 (2354054) | 2354054..2354368 | + | 315 | WP_058653112.1 | hypothetical protein | - |
NP441_RS11565 (2354365) | 2354365..2354654 | - | 290 | Protein_2259 | Arm DNA-binding domain-containing protein | - |
NP441_RS11570 (2355090) | 2355090..2355398 | - | 309 | WP_001199743.1 | CcdB family protein | Toxin |
NP441_RS11575 (2355401) | 2355401..2355640 | - | 240 | WP_001118105.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
NP441_RS11580 (2355749) | 2355749..2355997 | - | 249 | WP_000168388.1 | ribbon-helix-helix domain-containing protein | - |
NP441_RS11585 (2356074) | 2356074..2356382 | - | 309 | Protein_2263 | DUF4942 domain-containing protein | - |
NP441_RS11590 (2356402) | 2356402..2357379 | - | 978 | WP_223156503.1 | IS630 family transposase | - |
NP441_RS11600 (2358137) | 2358137..2359156 | + | 1020 | WP_000152563.1 | NAD(P)-dependent alcohol dehydrogenase | - |
NP441_RS11605 (2359184) | 2359184..2359714 | - | 531 | WP_000896756.1 | gluconokinase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 2356402..2357334 | 932 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11845.67 Da Isoelectric Point: 6.7228
>T252868 WP_001199743.1 NZ_CP101907:c2355398-2355090 [Salmonella enterica subsp. enterica]
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6C6Z9V9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H9SZK8 |