Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1690461..1691081 | Replicon | chromosome |
Accession | NZ_CP101907 | ||
Organism | Salmonella enterica subsp. enterica strain QA-1986 973 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | NP441_RS08585 | Protein ID | WP_001280991.1 |
Coordinates | 1690863..1691081 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | NP441_RS08580 | Protein ID | WP_000344807.1 |
Coordinates | 1690461..1690835 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NP441_RS08570 (1685600) | 1685600..1686793 | + | 1194 | WP_001039200.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
NP441_RS08575 (1686816) | 1686816..1689965 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
NP441_RS08580 (1690461) | 1690461..1690835 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
NP441_RS08585 (1690863) | 1690863..1691081 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
NP441_RS08590 (1691260) | 1691260..1691811 | + | 552 | WP_001278792.1 | maltose O-acetyltransferase | - |
NP441_RS08595 (1691928) | 1691928..1692398 | + | 471 | WP_000136181.1 | YlaC family protein | - |
NP441_RS08600 (1692454) | 1692454..1692594 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
NP441_RS08605 (1692600) | 1692600..1692860 | - | 261 | WP_000801421.1 | type B 50S ribosomal protein L31 | - |
NP441_RS08610 (1693085) | 1693085..1694635 | + | 1551 | WP_000213145.1 | EAL domain-containing protein | - |
NP441_RS08620 (1694866) | 1694866..1695255 | + | 390 | WP_000961285.1 | MGMT family protein | - |
NP441_RS08625 (1695288) | 1695288..1695857 | - | 570 | WP_000779803.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T252866 WP_001280991.1 NZ_CP101907:1690863-1691081 [Salmonella enterica subsp. enterica]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT252866 WP_000344807.1 NZ_CP101907:1690461-1690835 [Salmonella enterica subsp. enterica]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|