Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1293917..1294834 | Replicon | chromosome |
Accession | NZ_CP101904 | ||
Organism | Bacillus velezensis strain Ba-0321 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | I2HQ15 |
Locus tag | NPS25_RS06680 | Protein ID | WP_007407256.1 |
Coordinates | 1294088..1294834 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | I2HQ14 |
Locus tag | NPS25_RS06675 | Protein ID | WP_003154807.1 |
Coordinates | 1293917..1294087 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NPS25_RS06635 (NPS25_06635) | 1289140..1290771 | + | 1632 | WP_015417294.1 | pyocin knob domain-containing protein | - |
NPS25_RS06640 (NPS25_06640) | 1290784..1291155 | + | 372 | WP_015417295.1 | XkdW family protein | - |
NPS25_RS06645 (NPS25_06645) | 1291160..1291357 | + | 198 | WP_012117366.1 | XkdX family protein | - |
NPS25_RS06650 (NPS25_06650) | 1291414..1292175 | + | 762 | WP_031378811.1 | hypothetical protein | - |
NPS25_RS06655 (NPS25_06655) | 1292227..1292490 | + | 264 | WP_031378810.1 | hemolysin XhlA family protein | - |
NPS25_RS06660 (NPS25_06660) | 1292504..1292767 | + | 264 | WP_003154813.1 | phage holin | - |
NPS25_RS06665 (NPS25_06665) | 1292781..1293659 | + | 879 | WP_031378809.1 | N-acetylmuramoyl-L-alanine amidase | - |
NPS25_RS06670 (NPS25_06670) | 1293695..1293820 | - | 126 | WP_023356844.1 | hypothetical protein | - |
NPS25_RS06675 (NPS25_06675) | 1293917..1294087 | - | 171 | WP_003154807.1 | type II toxin-antitoxin system SpoIISB family antitoxin | Antitoxin |
NPS25_RS06680 (NPS25_06680) | 1294088..1294834 | - | 747 | WP_007407256.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
NPS25_RS06685 (NPS25_06685) | 1294939..1295937 | - | 999 | WP_003154805.1 | inorganic phosphate transporter | - |
NPS25_RS06690 (NPS25_06690) | 1295950..1296567 | - | 618 | WP_003154804.1 | DUF47 domain-containing protein | - |
NPS25_RS06695 (NPS25_06695) | 1296853..1298169 | - | 1317 | WP_007610842.1 | amino acid permease | - |
NPS25_RS06700 (NPS25_06700) | 1298492..1299442 | + | 951 | WP_031378808.1 | ring-cleaving dioxygenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29077.57 Da Isoelectric Point: 4.7755
>T252860 WP_007407256.1 NZ_CP101904:c1294834-1294088 [Bacillus velezensis]
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVLGSMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYAEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQNRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVLGSMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYAEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQNRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|