Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 546102..546739 | Replicon | chromosome |
Accession | NZ_CP101904 | ||
Organism | Bacillus velezensis strain Ba-0321 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | NPS25_RS02655 | Protein ID | WP_003156187.1 |
Coordinates | 546389..546739 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | I2HMS5 |
Locus tag | NPS25_RS02650 | Protein ID | WP_003156188.1 |
Coordinates | 546102..546383 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NPS25_RS02630 (NPS25_02630) | 542467..543066 | - | 600 | WP_003156193.1 | rhomboid family intramembrane serine protease | - |
NPS25_RS02635 (NPS25_02635) | 543159..543524 | + | 366 | WP_007410229.1 | holo-ACP synthase | - |
NPS25_RS02640 (NPS25_02640) | 543689..544696 | + | 1008 | WP_007410230.1 | outer membrane lipoprotein carrier protein LolA | - |
NPS25_RS02645 (NPS25_02645) | 544813..545982 | + | 1170 | WP_039252648.1 | alanine racemase | - |
NPS25_RS02650 (NPS25_02650) | 546102..546383 | + | 282 | WP_003156188.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
NPS25_RS02655 (NPS25_02655) | 546389..546739 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
NPS25_RS02660 (NPS25_02660) | 546857..547678 | + | 822 | WP_003156182.1 | STAS domain-containing protein | - |
NPS25_RS02665 (NPS25_02665) | 547683..548048 | + | 366 | WP_003156180.1 | RsbT antagonist protein RsbS | - |
NPS25_RS02670 (NPS25_02670) | 548051..548452 | + | 402 | WP_003156178.1 | anti-sigma regulatory factor | - |
NPS25_RS02675 (NPS25_02675) | 548464..549471 | + | 1008 | WP_015416875.1 | PP2C family protein-serine/threonine phosphatase | - |
NPS25_RS02680 (NPS25_02680) | 549535..549864 | + | 330 | WP_033575044.1 | anti-sigma factor antagonist | - |
NPS25_RS02685 (NPS25_02685) | 549861..550343 | + | 483 | WP_007609591.1 | anti-sigma B factor RsbW | - |
NPS25_RS02690 (NPS25_02690) | 550309..551097 | + | 789 | WP_003156171.1 | RNA polymerase sigma factor SigB | - |
NPS25_RS02695 (NPS25_02695) | 551097..551699 | + | 603 | WP_007410234.1 | PP2C family serine/threonine-protein phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T252859 WP_003156187.1 NZ_CP101904:546389-546739 [Bacillus velezensis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|