Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 102741..103342 Replicon plasmid p1
Accession NZ_CP101878
Organism Klebsiella pneumoniae strain KPA1

Toxin (Protein)


Gene name doc Uniprot ID V0AJ64
Locus tag NNX43_RS26355 Protein ID WP_001216034.1
Coordinates 102962..103342 (+) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag NNX43_RS26350 Protein ID WP_001190712.1
Coordinates 102741..102962 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NNX43_RS26340 (99734) 99734..101005 - 1272 WP_048266692.1 restriction endonuclease subunit S -
NNX43_RS26345 (101002) 101002..102558 - 1557 WP_001553856.1 type I restriction-modification system subunit M -
NNX43_RS26350 (102741) 102741..102962 + 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NNX43_RS26355 (102962) 102962..103342 + 381 WP_001216034.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
NNX43_RS26360 (103347) 103347..103526 + 180 WP_001513661.1 hypothetical protein -
NNX43_RS26365 (103554) 103554..103832 + 279 Protein_122 pdcB -
NNX43_RS26370 (103837) 103837..104250 + 414 Protein_123 integrase core domain-containing protein -
NNX43_RS26375 (104200) 104200..104535 - 336 WP_169329198.1 type I deoxyribonuclease HsdR -
NNX43_RS26380 (104745) 104745..105725 - 981 WP_000019407.1 IS5-like element IS5 family transposase -
NNX43_RS26385 (105969) 105969..107372 + 1404 WP_001373486.1 S-methylmethionine permease -
NNX43_RS26390 (107359) 107359..108291 + 933 WP_000081352.1 homocysteine S-methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid tet(B) / dfrA12 / aadA2 / qacE / sul1 - 1..111444 111444


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(2-123)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13615.32 Da        Isoelectric Point: 5.1514

>T252847 WP_001216034.1 NZ_CP101878:102962-103342 [Klebsiella pneumoniae]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT252847 WP_001190712.1 NZ_CP101878:102741-102962 [Klebsiella pneumoniae]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0AJ64

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References