Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 83630..84155 | Replicon | plasmid p1 |
Accession | NZ_CP101878 | ||
Organism | Klebsiella pneumoniae strain KPA1 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | V0SSI5 |
Locus tag | NNX43_RS26275 | Protein ID | WP_001159868.1 |
Coordinates | 83630..83935 (-) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | S1PPD8 |
Locus tag | NNX43_RS26280 | Protein ID | WP_000813634.1 |
Coordinates | 83937..84155 (-) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NNX43_RS26260 (79540) | 79540..80706 | - | 1167 | WP_000772446.1 | plasmid-partitioning protein SopA | - |
NNX43_RS26265 (81294) | 81294..82049 | - | 756 | WP_000852146.1 | replication initiation protein RepE | - |
NNX43_RS26270 (82823) | 82823..83629 | - | 807 | WP_000016982.1 | site-specific integrase | - |
NNX43_RS26275 (83630) | 83630..83935 | - | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
NNX43_RS26280 (83937) | 83937..84155 | - | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
NNX43_RS26285 (84789) | 84789..84986 | + | 198 | WP_000215657.1 | hypothetical protein | - |
NNX43_RS26290 (84983) | 84983..85267 | - | 285 | WP_000642771.1 | hypothetical protein | - |
NNX43_RS26295 (85287) | 85287..86420 | - | 1134 | WP_000545983.1 | DUF3800 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | tet(B) / dfrA12 / aadA2 / qacE / sul1 | - | 1..111444 | 111444 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11706.51 Da Isoelectric Point: 6.4674
>T252845 WP_001159868.1 NZ_CP101878:c83935-83630 [Klebsiella pneumoniae]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|