Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RHH(antitoxin)
Location 5213..5772 Replicon plasmid p1
Accession NZ_CP101878
Organism Klebsiella pneumoniae strain KPA1

Toxin (Protein)


Gene name relE Uniprot ID V0SVC8
Locus tag NNX43_RS25795 Protein ID WP_000421272.1
Coordinates 5213..5488 (-) Length 92 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID V0SRR3
Locus tag NNX43_RS25800 Protein ID WP_001387467.1
Coordinates 5488..5772 (-) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NNX43_RS25760 (1263) 1263..2003 - 741 WP_001066942.1 tyrosine-type recombinase/integrase -
NNX43_RS25765 (2124) 2124..2306 - 183 WP_042065278.1 hypothetical protein -
NNX43_RS25770 (2373) 2373..2662 - 290 Protein_3 type II toxin-antitoxin system RelE/ParE family toxin -
NNX43_RS25775 (2649) 2649..2917 - 269 Protein_4 type II toxin-antitoxin system ParD family antitoxin -
NNX43_RS25780 (3449) 3449..4618 + 1170 WP_001072355.1 hypothetical protein -
NNX43_RS25785 (4651) 4651..4779 + 129 Protein_6 IS481 family transposase -
NNX43_RS25790 (4814) 4814..5107 - 294 WP_001105060.1 hypothetical protein -
NNX43_RS25795 (5213) 5213..5488 - 276 WP_000421272.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NNX43_RS25800 (5488) 5488..5772 - 285 WP_001387467.1 ribbon-helix-helix domain-containing protein Antitoxin
NNX43_RS25805 (6426) 6426..7123 + 698 WP_151884388.1 IS1 family transposase -
NNX43_RS25810 (7138) 7138..8301 + 1164 Protein_11 IS4-like element ISVsa5 family transposase -
NNX43_RS25815 (8311) 8311..8727 - 417 WP_000275180.1 AraC family transcriptional regulator -
NNX43_RS25820 (8815) 8815..9408 + 594 WP_000428546.1 tetracyline resistance-associated transcriptional repressor TetC -
NNX43_RS25825 (9521) 9521..10726 - 1206 WP_001089068.1 tetracycline efflux MFS transporter Tet(B) -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid tet(B) / dfrA12 / aadA2 / qacE / sul1 - 1..111444 111444


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-90)

Antitoxin

Ribbon-helix-helix protein, CopG

(14-51)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10749.45 Da        Isoelectric Point: 10.0871

>T252844 WP_000421272.1 NZ_CP101878:c5488-5213 [Klebsiella pneumoniae]
MELKWTSKALSDLSRLFDFLVLASKPAAARTVQSLTQAPVILLTHPRMGEQLFQFEPREVRRIFAGEYEIRYEINGQTIY
VLRLWHTRENR

Download         Length: 276 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10460.87 Da        Isoelectric Point: 5.6558

>AT252844 WP_001387467.1 NZ_CP101878:c5772-5488 [Klebsiella pneumoniae]
MQMKNNAAQATKVITAHVPLPMADKVDQMAARLERSRGWVIKQALSAWLAQEEERNRLTLEALDDVTSGQVIDHQAVQAW
SDSLSTDNPLPVPR

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0SVC8

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0Y880

References