Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 5192862..5193487 | Replicon | chromosome |
| Accession | NZ_CP101877 | ||
| Organism | Klebsiella pneumoniae strain KPA1 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | NNX43_RS25390 | Protein ID | WP_040182550.1 |
| Coordinates | 5192862..5193245 (-) | Length | 128 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | J2DFR0 |
| Locus tag | NNX43_RS25395 | Protein ID | WP_004150355.1 |
| Coordinates | 5193245..5193487 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NNX43_RS25375 (5190228) | 5190228..5191130 | + | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
| NNX43_RS25380 (5191127) | 5191127..5191762 | + | 636 | WP_002882818.1 | formate dehydrogenase cytochrome b556 subunit | - |
| NNX43_RS25385 (5191759) | 5191759..5192688 | + | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
| NNX43_RS25390 (5192862) | 5192862..5193245 | - | 384 | WP_040182550.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NNX43_RS25395 (5193245) | 5193245..5193487 | - | 243 | WP_004150355.1 | CopG family transcriptional regulator | Antitoxin |
| NNX43_RS25400 (5193692) | 5193692..5194609 | + | 918 | WP_023302328.1 | alpha/beta hydrolase | - |
| NNX43_RS25405 (5194623) | 5194623..5195564 | - | 942 | WP_004178031.1 | fatty acid biosynthesis protein FabY | - |
| NNX43_RS25410 (5195609) | 5195609..5196046 | - | 438 | WP_002882809.1 | D-aminoacyl-tRNA deacylase | - |
| NNX43_RS25415 (5196043) | 5196043..5196903 | - | 861 | WP_004146232.1 | virulence factor BrkB family protein | - |
| NNX43_RS25420 (5196897) | 5196897..5197496 | - | 600 | WP_004151865.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14376.67 Da Isoelectric Point: 9.5352
>T252843 WP_040182550.1 NZ_CP101877:c5193245-5192862 [Klebsiella pneumoniae]
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLKLITRNTKDFAGIPGVVTPYEIHPE
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLKLITRNTKDFAGIPGVVTPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|