Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4007008..4007627 Replicon chromosome
Accession NZ_CP101877
Organism Klebsiella pneumoniae strain KPA1

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag NNX43_RS19760 Protein ID WP_002892050.1
Coordinates 4007409..4007627 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag NNX43_RS19755 Protein ID WP_002892066.1
Coordinates 4007008..4007382 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NNX43_RS19745 (4002160) 4002160..4003353 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
NNX43_RS19750 (4003376) 4003376..4006522 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
NNX43_RS19755 (4007008) 4007008..4007382 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
NNX43_RS19760 (4007409) 4007409..4007627 + 219 WP_002892050.1 HHA domain-containing protein Toxin
NNX43_RS19765 (4007790) 4007790..4008356 + 567 WP_002892030.1 maltose O-acetyltransferase -
NNX43_RS19770 (4008328) 4008328..4008468 - 141 WP_004147370.1 hypothetical protein -
NNX43_RS19775 (4008489) 4008489..4008959 + 471 WP_040182126.1 YlaC family protein -
NNX43_RS19780 (4008934) 4008934..4010385 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
NNX43_RS19785 (4010486) 4010486..4011184 + 699 WP_002892021.1 GNAT family protein -
NNX43_RS19790 (4011181) 4011181..4011321 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
NNX43_RS19795 (4011321) 4011321..4011584 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T252839 WP_002892050.1 NZ_CP101877:4007409-4007627 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT252839 WP_002892066.1 NZ_CP101877:4007008-4007382 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References