Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 4007008..4007627 | Replicon | chromosome |
| Accession | NZ_CP101877 | ||
| Organism | Klebsiella pneumoniae strain KPA1 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | R8WYV2 |
| Locus tag | NNX43_RS19760 | Protein ID | WP_002892050.1 |
| Coordinates | 4007409..4007627 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | J2DPF6 |
| Locus tag | NNX43_RS19755 | Protein ID | WP_002892066.1 |
| Coordinates | 4007008..4007382 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NNX43_RS19745 (4002160) | 4002160..4003353 | + | 1194 | WP_004177236.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| NNX43_RS19750 (4003376) | 4003376..4006522 | + | 3147 | WP_002892069.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| NNX43_RS19755 (4007008) | 4007008..4007382 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
| NNX43_RS19760 (4007409) | 4007409..4007627 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
| NNX43_RS19765 (4007790) | 4007790..4008356 | + | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
| NNX43_RS19770 (4008328) | 4008328..4008468 | - | 141 | WP_004147370.1 | hypothetical protein | - |
| NNX43_RS19775 (4008489) | 4008489..4008959 | + | 471 | WP_040182126.1 | YlaC family protein | - |
| NNX43_RS19780 (4008934) | 4008934..4010385 | - | 1452 | WP_002892023.1 | PLP-dependent aminotransferase family protein | - |
| NNX43_RS19785 (4010486) | 4010486..4011184 | + | 699 | WP_002892021.1 | GNAT family protein | - |
| NNX43_RS19790 (4011181) | 4011181..4011321 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
| NNX43_RS19795 (4011321) | 4011321..4011584 | - | 264 | WP_002892011.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T252839 WP_002892050.1 NZ_CP101877:4007409-4007627 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT252839 WP_002892066.1 NZ_CP101877:4007008-4007382 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2P8K6F2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GJ93 |