Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RelE-RHH
Location 7045..7592 Replicon plasmid pLP5-1-37kb
Accession NZ_CP101869
Organism Escherichia coli strain LP5-1

Toxin (Protein)


Gene name parE Uniprot ID -
Locus tag NPX81_RS23215 Protein ID WP_244578848.1
Coordinates 7314..7592 (+) Length 93 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID A0A829FT18
Locus tag NPX81_RS23210 Protein ID WP_000079938.1
Coordinates 7045..7314 (+) Length 90 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NPX81_RS23175 (NPX81_23200) 2340..2630 - 291 WP_001471781.1 hypothetical protein -
NPX81_RS23180 (NPX81_23205) 3289..3624 + 336 WP_001039462.1 plasmid stabilization protein StbA -
NPX81_RS23185 (NPX81_23210) 3633..3824 + 192 WP_001515192.1 hypothetical protein -
NPX81_RS23190 (NPX81_23215) 3835..4418 - 584 Protein_5 IS1 family transposase -
NPX81_RS23195 (NPX81_23220) 4952..5707 + 756 WP_000807690.1 replication initiation protein RepE -
NPX81_RS23200 (NPX81_23225) 5976..6321 + 346 Protein_7 IS1 family transposase -
NPX81_RS23205 (NPX81_23230) 6832..6972 + 141 WP_160784086.1 hypothetical protein -
NPX81_RS23210 (NPX81_23235) 7045..7314 + 270 WP_000079938.1 type II toxin-antitoxin system antitoxin YacA Antitoxin
NPX81_RS23215 (NPX81_23240) 7314..7592 + 279 WP_244578848.1 type II toxin-antitoxin system toxin YacB Toxin
NPX81_RS23220 (NPX81_23245) 7628..9379 - 1752 Protein_11 Tn3-like element TnAs1 family transposase -
NPX81_RS23225 (NPX81_23250) 9383..9775 + 393 WP_001351729.1 isochorismatase family cysteine hydrolase -
NPX81_RS23230 (NPX81_23255) 9913..10797 + 885 WP_000058717.1 EamA family transporter -
NPX81_RS23235 (NPX81_23260) 10829..12028 - 1200 WP_001493765.1 tetracycline efflux MFS transporter Tet(A) -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid tet(A) / dfrA12 / aadA2 / cmlA1 / ant(3'')-Ia / sul3 - 1..37779 37779
- inside IScluster/Tn tet(A) / dfrA12 / aadA2 / cmlA1 / ant(3'')-Ia / sul3 - 1250..34407 33157


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-91)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 93 a.a.        Molecular weight: 10729.39 Da        Isoelectric Point: 8.4615

>T252830 WP_244578848.1 NZ_CP101869:7314-7592 [Escherichia coli]
MEIFWTMLASQDRKRIREYIAEQNLMVAIELDERIGYSASSLAGQPYKGRNGRVEGARELVIHPHFVLVYEVDSPWGKVY
ILRVLHTAQKWP

Download         Length: 279 bp

Antitoxin


Download         Length: 90 a.a.        Molecular weight: 10251.64 Da        Isoelectric Point: 10.1734

>AT252830 WP_000079938.1 NZ_CP101869:7045-7314 [Escherichia coli]
MAQVNMSLRIDAELKDAFMAAAKSMDRNGSQLIRDFMRQTVERQHNTWFRDQVAAGRQQLKRGDVLPHDMVESSAAAWRD
EMSRKVADK

Download         Length: 270 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A829FT18

References