Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-Phd |
| Location | 23825..24426 | Replicon | plasmid pLP5-1-106kb |
| Accession | NZ_CP101867 | ||
| Organism | Escherichia coli strain LP5-1 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | V0AJ64 |
| Locus tag | NPX81_RS22345 | Protein ID | WP_001216034.1 |
| Coordinates | 23825..24205 (-) | Length | 127 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | U9YQH9 |
| Locus tag | NPX81_RS22350 | Protein ID | WP_001190712.1 |
| Coordinates | 24205..24426 (-) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NPX81_RS22310 (18900) | 18900..19823 | - | 924 | Protein_23 | homocysteine S-methyltransferase | - |
| NPX81_RS22315 (19810) | 19810..21200 | - | 1391 | Protein_24 | S-methylmethionine permease | - |
| NPX81_RS22320 (21444) | 21444..22422 | + | 979 | Protein_25 | IS5-like element IS5 family transposase | - |
| NPX81_RS22325 (22632) | 22632..22967 | + | 336 | WP_169329198.1 | type I deoxyribonuclease HsdR | - |
| NPX81_RS22330 (22917) | 22917..23330 | - | 414 | Protein_27 | integrase core domain-containing protein | - |
| NPX81_RS22335 (23335) | 23335..23613 | - | 279 | Protein_28 | pdcB | - |
| NPX81_RS22340 (23641) | 23641..23820 | - | 180 | WP_001513661.1 | hypothetical protein | - |
| NPX81_RS22345 (23825) | 23825..24205 | - | 381 | WP_001216034.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| NPX81_RS22350 (24205) | 24205..24426 | - | 222 | WP_001190712.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| NPX81_RS22355 (24609) | 24609..26165 | + | 1557 | WP_001617892.1 | type I restriction-modification system subunit M | - |
| NPX81_RS22360 (26162) | 26162..27445 | + | 1284 | WP_001617890.1 | restriction endonuclease subunit S | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | mef(B) / aph(3')-Ia | - | 1..106681 | 106681 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13615.32 Da Isoelectric Point: 5.1514
>T252824 WP_001216034.1 NZ_CP101867:c24205-23825 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V0AJ64 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CJB6 |