Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 23825..24426 Replicon plasmid pLP5-1-106kb
Accession NZ_CP101867
Organism Escherichia coli strain LP5-1

Toxin (Protein)


Gene name doc Uniprot ID V0AJ64
Locus tag NPX81_RS22345 Protein ID WP_001216034.1
Coordinates 23825..24205 (-) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag NPX81_RS22350 Protein ID WP_001190712.1
Coordinates 24205..24426 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NPX81_RS22310 (18900) 18900..19823 - 924 Protein_23 homocysteine S-methyltransferase -
NPX81_RS22315 (19810) 19810..21200 - 1391 Protein_24 S-methylmethionine permease -
NPX81_RS22320 (21444) 21444..22422 + 979 Protein_25 IS5-like element IS5 family transposase -
NPX81_RS22325 (22632) 22632..22967 + 336 WP_169329198.1 type I deoxyribonuclease HsdR -
NPX81_RS22330 (22917) 22917..23330 - 414 Protein_27 integrase core domain-containing protein -
NPX81_RS22335 (23335) 23335..23613 - 279 Protein_28 pdcB -
NPX81_RS22340 (23641) 23641..23820 - 180 WP_001513661.1 hypothetical protein -
NPX81_RS22345 (23825) 23825..24205 - 381 WP_001216034.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
NPX81_RS22350 (24205) 24205..24426 - 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NPX81_RS22355 (24609) 24609..26165 + 1557 WP_001617892.1 type I restriction-modification system subunit M -
NPX81_RS22360 (26162) 26162..27445 + 1284 WP_001617890.1 restriction endonuclease subunit S -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid mef(B) / aph(3')-Ia - 1..106681 106681


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(2-123)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13615.32 Da        Isoelectric Point: 5.1514

>T252824 WP_001216034.1 NZ_CP101867:c24205-23825 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT252824 WP_001190712.1 NZ_CP101867:c24426-24205 [Escherichia coli]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0AJ64

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References