Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
Location | 4018519..4019114 | Replicon | chromosome |
Accession | NZ_CP101866 | ||
Organism | Escherichia coli strain LP5-1 |
Toxin (Protein)
Gene name | chpB | Uniprot ID | - |
Locus tag | NPX81_RS19630 | Protein ID | WP_112934936.1 |
Coordinates | 4018764..4019114 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | chpS | Uniprot ID | U9Y2K1 |
Locus tag | NPX81_RS19625 | Protein ID | WP_001223208.1 |
Coordinates | 4018519..4018770 (+) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NPX81_RS19615 (4014184) | 4014184..4017963 | + | 3780 | WP_089619462.1 | autotransporter assembly complex protein TamB | - |
NPX81_RS19620 (4017966) | 4017966..4018307 | + | 342 | WP_001219160.1 | gamma-glutamylcyclotransferase | - |
NPX81_RS19625 (4018519) | 4018519..4018770 | + | 252 | WP_001223208.1 | type II toxin-antitoxin system antitoxin ChpS | Antitoxin |
NPX81_RS19630 (4018764) | 4018764..4019114 | + | 351 | WP_112934936.1 | endoribonuclease toxin ChpB | Toxin |
NPX81_RS19635 (4019191) | 4019191..4019721 | - | 531 | WP_000055070.1 | inorganic diphosphatase | - |
NPX81_RS19640 (4020031) | 4020031..4020987 | + | 957 | WP_000265942.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
NPX81_RS19645 (4021127) | 4021127..4022629 | + | 1503 | WP_000205807.1 | sugar ABC transporter ATP-binding protein | - |
NPX81_RS19650 (4022643) | 4022643..4023665 | + | 1023 | WP_053292440.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12526.42 Da Isoelectric Point: 5.6219
>T252822 WP_112934936.1 NZ_CP101866:4018764-4019114 [Escherichia coli]
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARQAKRIGLAADEVVEEALLRLQAVVE
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARQAKRIGLAADEVVEEALLRLQAVVE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|