Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yafW-ykfI/CbtA-CbeA |
Location | 3534801..3535480 | Replicon | chromosome |
Accession | NZ_CP101866 | ||
Organism | Escherichia coli strain LP5-1 |
Toxin (Protein)
Gene name | ykfI | Uniprot ID | S1FHS4 |
Locus tag | NPX81_RS17120 | Protein ID | WP_000854680.1 |
Coordinates | 3535139..3535480 (+) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | yafW | Uniprot ID | S1EWR7 |
Locus tag | NPX81_RS17115 | Protein ID | WP_000070396.1 |
Coordinates | 3534801..3535118 (+) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NPX81_RS17070 (3530239) | 3530239..3531060 | + | 822 | WP_230069315.1 | DUF932 domain-containing protein | - |
NPX81_RS17075 (3531277) | 3531277..3531978 | + | 702 | WP_001581462.1 | WYL domain-containing protein | - |
NPX81_RS17080 (3532019) | 3532019..3532255 | + | 237 | WP_001144031.1 | protein YpjK | - |
NPX81_RS17085 (3532255) | 3532255..3532698 | + | 444 | WP_032199444.1 | lipoprotein YafY | - |
NPX81_RS17090 (3532721) | 3532721..3533188 | + | 468 | WP_032200803.1 | protein YkfB | - |
NPX81_RS17095 (3533265) | 3533265..3533504 | + | 240 | WP_180513156.1 | DUF905 domain-containing protein | - |
NPX81_RS17100 (3533602) | 3533602..3534060 | + | 459 | WP_032177818.1 | antirestriction protein | - |
NPX81_RS17105 (3534076) | 3534076..3534552 | + | 477 | WP_072667534.1 | RadC family protein | - |
NPX81_RS17110 (3534561) | 3534561..3534782 | + | 222 | WP_000691994.1 | DUF987 domain-containing protein | - |
NPX81_RS17115 (3534801) | 3534801..3535118 | + | 318 | WP_000070396.1 | type IV toxin-antitoxin system antitoxin YafW | Antitoxin |
NPX81_RS17120 (3535139) | 3535139..3535480 | + | 342 | WP_000854680.1 | type IV toxin-antitoxin system toxin YkfI | Toxin |
NPX81_RS17125 (3536024) | 3536024..3536224 | + | 201 | Protein_3351 | integrase | - |
NPX81_RS17130 (3536291) | 3536291..3537453 | + | 1163 | WP_085947771.1 | IS3-like element IS3 family transposase | - |
NPX81_RS17135 (3537483) | 3537483..3538562 | + | 1080 | Protein_3353 | tyrosine-type recombinase/integrase | - |
NPX81_RS17140 (3538643) | 3538643..3539353 | - | 711 | WP_230069332.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 3533602..3607111 | 73509 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12892.95 Da Isoelectric Point: 9.6543
>T252817 WP_000854680.1 NZ_CP101866:3535139-3535480 [Escherichia coli]
MKTLPATTQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAADILRARQATGLLRQSRNNVVR
MKTLPATTQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAADILRARQATGLLRQSRNNVVR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|