Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3352781..3353399 | Replicon | chromosome |
Accession | NZ_CP101866 | ||
Organism | Escherichia coli strain LP5-1 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | NPX81_RS16245 | Protein ID | WP_001291435.1 |
Coordinates | 3353181..3353399 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | NPX81_RS16240 | Protein ID | WP_000344800.1 |
Coordinates | 3352781..3353155 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NPX81_RS16230 (3347870) | 3347870..3349063 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
NPX81_RS16235 (3349086) | 3349086..3352235 | + | 3150 | WP_001132473.1 | efflux RND transporter permease AcrB | - |
NPX81_RS16240 (3352781) | 3352781..3353155 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
NPX81_RS16245 (3353181) | 3353181..3353399 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
NPX81_RS16250 (3353571) | 3353571..3354122 | + | 552 | WP_180513029.1 | maltose O-acetyltransferase | - |
NPX81_RS16255 (3354238) | 3354238..3354708 | + | 471 | WP_000136192.1 | YlaC family protein | - |
NPX81_RS16260 (3354872) | 3354872..3356422 | + | 1551 | WP_001310610.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
NPX81_RS16265 (3356464) | 3356464..3356817 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
NPX81_RS16275 (3357196) | 3357196..3357507 | + | 312 | WP_000409911.1 | MGMT family protein | - |
NPX81_RS16280 (3357538) | 3357538..3358110 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T252815 WP_001291435.1 NZ_CP101866:3353181-3353399 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT252815 WP_000344800.1 NZ_CP101866:3352781-3353155 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |