Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2440150..2440788 | Replicon | chromosome |
| Accession | NZ_CP101866 | ||
| Organism | Escherichia coli strain LP5-1 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A2X7GI71 |
| Locus tag | NPX81_RS11855 | Protein ID | WP_032231106.1 |
| Coordinates | 2440612..2440788 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | NPX81_RS11850 | Protein ID | WP_001270286.1 |
| Coordinates | 2440150..2440566 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NPX81_RS11830 (2435302) | 2435302..2436243 | - | 942 | WP_001251313.1 | ABC transporter permease | - |
| NPX81_RS11835 (2436244) | 2436244..2437257 | - | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
| NPX81_RS11840 (2437275) | 2437275..2438420 | - | 1146 | WP_000047429.1 | ABC transporter substrate-binding protein | - |
| NPX81_RS11845 (2438665) | 2438665..2440071 | - | 1407 | WP_000760626.1 | PLP-dependent aminotransferase family protein | - |
| NPX81_RS11850 (2440150) | 2440150..2440566 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| NPX81_RS11855 (2440612) | 2440612..2440788 | - | 177 | WP_032231106.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| NPX81_RS11860 (2441010) | 2441010..2441240 | + | 231 | WP_000494244.1 | YncJ family protein | - |
| NPX81_RS11865 (2441332) | 2441332..2443293 | - | 1962 | WP_001491066.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| NPX81_RS11870 (2443366) | 2443366..2443902 | - | 537 | WP_000429151.1 | DNA-binding transcriptional regulator SutR | - |
| NPX81_RS11875 (2443994) | 2443994..2445166 | + | 1173 | WP_001236310.1 | BenE family transporter YdcO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 2445220..2445723 | 503 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6680.72 Da Isoelectric Point: 10.9223
>T252814 WP_032231106.1 NZ_CP101866:c2440788-2440612 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPCHPSDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPCHPSDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT252814 WP_001270286.1 NZ_CP101866:c2440566-2440150 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|