Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 993297..993880 | Replicon | chromosome |
Accession | NZ_CP101866 | ||
Organism | Escherichia coli strain LP5-1 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | NPX81_RS04800 | Protein ID | WP_089601808.1 |
Coordinates | 993545..993880 (+) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | A0A161R357 |
Locus tag | NPX81_RS04795 | Protein ID | WP_040062758.1 |
Coordinates | 993297..993545 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NPX81_RS04785 (989636) | 989636..990937 | + | 1302 | WP_040062759.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
NPX81_RS04790 (990985) | 990985..993219 | + | 2235 | WP_000226815.1 | GTP pyrophosphokinase | - |
NPX81_RS04795 (993297) | 993297..993545 | + | 249 | WP_040062758.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
NPX81_RS04800 (993545) | 993545..993880 | + | 336 | WP_089601808.1 | endoribonuclease MazF | Toxin |
NPX81_RS04805 (993951) | 993951..994742 | + | 792 | WP_001071643.1 | nucleoside triphosphate pyrophosphohydrolase | - |
NPX81_RS04810 (994970) | 994970..996607 | + | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
NPX81_RS04815 (996695) | 996695..997993 | + | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12142.09 Da Isoelectric Point: 8.2618
>T252807 WP_089601808.1 NZ_CP101866:993545-993880 [Escherichia coli]
MVSRYVPDMGDLIWVDFDPTKSSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTLAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKSSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTLAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|