Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 853955..854609 | Replicon | chromosome |
Accession | NZ_CP101866 | ||
Organism | Escherichia coli strain LP5-1 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1EEB2 |
Locus tag | NPX81_RS04205 | Protein ID | WP_000244777.1 |
Coordinates | 854202..854609 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | NPX81_RS04200 | Protein ID | WP_000354046.1 |
Coordinates | 853955..854221 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NPX81_RS04175 (849124) | 849124..849867 | + | 744 | WP_000951948.1 | SDR family oxidoreductase | - |
NPX81_RS04180 (849924) | 849924..851357 | - | 1434 | WP_040062540.1 | 6-phospho-beta-glucosidase BglA | - |
NPX81_RS04185 (851402) | 851402..851713 | + | 312 | WP_001182947.1 | N(4)-acetylcytidine aminohydrolase | - |
NPX81_RS04190 (851877) | 851877..852536 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
NPX81_RS04195 (852732) | 852732..853712 | - | 981 | WP_000886062.1 | tRNA-modifying protein YgfZ | - |
NPX81_RS04200 (853955) | 853955..854221 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
NPX81_RS04205 (854202) | 854202..854609 | + | 408 | WP_000244777.1 | protein YgfX | Toxin |
NPX81_RS04210 (854649) | 854649..855170 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
NPX81_RS04215 (855282) | 855282..856178 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
NPX81_RS04220 (856203) | 856203..856913 | + | 711 | WP_000715214.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
NPX81_RS04225 (856919) | 856919..858652 | + | 1734 | WP_180512836.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16031.96 Da Isoelectric Point: 11.5202
>T252806 WP_000244777.1 NZ_CP101866:854202-854609 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9LFV7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QD57 |