Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 690203..691044 | Replicon | chromosome |
Accession | NZ_CP101866 | ||
Organism | Escherichia coli strain LP5-1 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | A0A1M0WJM1 |
Locus tag | NPX81_RS03360 | Protein ID | WP_000854822.1 |
Coordinates | 690661..691044 (+) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | A0A1M0CWL2 |
Locus tag | NPX81_RS03355 | Protein ID | WP_053271974.1 |
Coordinates | 690203..690571 (+) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NPX81_RS03335 (687948) | 687948..688766 | + | 819 | WP_001234702.1 | DUF932 domain-containing protein | - |
NPX81_RS03340 (688857) | 688857..689342 | + | 486 | WP_042631074.1 | antirestriction protein | - |
NPX81_RS03345 (689357) | 689357..689833 | + | 477 | WP_001186747.1 | RadC family protein | - |
NPX81_RS03350 (689902) | 689902..690123 | + | 222 | WP_000692312.1 | DUF987 domain-containing protein | - |
NPX81_RS03355 (690203) | 690203..690571 | + | 369 | WP_053271974.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
NPX81_RS03360 (690661) | 690661..691044 | + | 384 | WP_000854822.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
NPX81_RS03365 (691035) | 691035..691523 | + | 489 | WP_001177592.1 | DUF5983 family protein | - |
NPX81_RS03370 (691535) | 691535..691732 | + | 198 | WP_000839263.1 | DUF957 domain-containing protein | - |
NPX81_RS03375 (691829) | 691829..692674 | + | 846 | WP_001280435.1 | DUF4942 domain-containing protein | - |
NPX81_RS03385 (692973) | 692973..693479 | + | 507 | WP_000228937.1 | G/U mismatch-specific DNA glycosylase | - |
NPX81_RS03390 (693558) | 693558..695399 | - | 1842 | WP_000437371.1 | RNA polymerase sigma factor RpoD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14295.32 Da Isoelectric Point: 8.2830
>T252805 WP_000854822.1 NZ_CP101866:690661-691044 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHQESKRCN
MKTLPVLPGQAASSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHQESKRCN
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1M0WJM1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1M0CWL2 |