Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/-
Location 22236..22828 Replicon plasmid pLP50-1-MCR1
Accession NZ_CP101861
Organism Escherichia coli strain LP50-1

Toxin (Protein)


Gene name hicA Uniprot ID V0AGQ2
Locus tag NPX80_RS24755 Protein ID WP_000520549.1
Coordinates 22236..22484 (+) Length 83 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID V0AWG0
Locus tag NPX80_RS24760 Protein ID WP_000681613.1
Coordinates 22481..22828 (+) Length 116 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NPX80_RS24725 (NPX80_24730) 19113..19628 + 516 WP_001025395.1 J domain-containing protein -
NPX80_RS24730 (NPX80_24735) 19733..20275 + 543 WP_001083906.1 hypothetical protein -
NPX80_RS24735 (NPX80_24740) 20272..20523 + 252 WP_001230707.1 hypothetical protein -
NPX80_RS24740 (NPX80_24745) 20510..20737 + 228 WP_000801440.1 hypothetical protein -
NPX80_RS24745 (NPX80_24750) 21191..21490 + 300 WP_256500690.1 hypothetical protein -
NPX80_RS24750 (NPX80_24755) 21581..21931 + 351 WP_000854259.1 hypothetical protein -
NPX80_RS24755 (NPX80_24760) 22236..22484 + 249 WP_000520549.1 type II toxin-antitoxin system HicA family toxin Toxin
NPX80_RS24760 (NPX80_24765) 22481..22828 + 348 WP_000681613.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
NPX80_RS24765 (NPX80_24770) 23189..23692 + 504 WP_000781813.1 relaxosome-coupling protein TaxA -
NPX80_RS24770 (NPX80_24775) 23696..24925 + 1230 WP_001329504.1 DNA relaxase/nickase TaxC -
NPX80_RS24775 (NPX80_24780) 25002..25295 + 294 WP_060598542.1 sigma factor-like helix-turn-helix DNA-binding protein -
NPX80_RS24780 (NPX80_24785) 25292..25507 + 216 WP_000760375.1 EexN family lipoprotein -
NPX80_RS24785 (NPX80_24790) 25863..26483 + 621 WP_000157549.1 lytic transglycosylase domain-containing protein -
NPX80_RS24790 (NPX80_24795) 26497..26823 + 327 WP_000008647.1 TrbC/VirB2 family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid mcr-1.1 - 1..33309 33309


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(20-81)

Antitoxin

Uncharacterised protein family HicB

(54-104)


Sequences

Toxin        


Download         Length: 83 a.a.        Molecular weight: 9422.08 Da        Isoelectric Point: 10.4800

>T252803 WP_000520549.1 NZ_CP101861:22236-22484 [Escherichia coli]
MGKTDKLLAKFLNSKKTFEWDELVVLFSSLGYVKKEMQGSRVRFFNAEINHTILMHRPHPESYIKGGTLKAIKQNLKEAG
LL

Download         Length: 249 bp

Antitoxin


Download         Length: 116 a.a.        Molecular weight: 13113.84 Da        Isoelectric Point: 4.6723

>AT252803 WP_000681613.1 NZ_CP101861:22481-22828 [Escherichia coli]
MKHLKYKGYLGTVEPDFENNVLYGKLAFIRDLVTYEASTLAELEQEFKTSVDLYLQSCVEDGKEPDTPFKGVFNVRLDPE
LHRRVAEMAMEEDLSLNAFVNKALEKEVSNHRAGA

Download         Length: 348 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CIX3

Antitoxin

Source ID Structure
AlphaFold DB A0A829CLC1

References