Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsxAB/MqsA(antitoxin)
Location 20272..20737 Replicon plasmid pLP50-1-MCR1
Accession NZ_CP101861
Organism Escherichia coli strain LP50-1

Toxin (Protein)


Gene name TsxA Uniprot ID U9ZUY2
Locus tag NPX80_RS24735 Protein ID WP_001230707.1
Coordinates 20272..20523 (+) Length 84 a.a.

Antitoxin (Protein)


Gene name TsxB Uniprot ID M7CCF8
Locus tag NPX80_RS24740 Protein ID WP_000801440.1
Coordinates 20510..20737 (+) Length 76 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NPX80_RS24710 (NPX80_24715) 15753..16280 - 528 WP_000577043.1 DUF2726 domain-containing protein -
NPX80_RS24715 (NPX80_24720) 16415..16819 - 405 WP_012421203.1 hypothetical protein -
NPX80_RS24720 (NPX80_24725) 16832..17698 - 867 WP_001353743.1 replication initiation protein -
NPX80_RS24725 (NPX80_24730) 19113..19628 + 516 WP_001025395.1 J domain-containing protein -
NPX80_RS24730 (NPX80_24735) 19733..20275 + 543 WP_001083906.1 hypothetical protein -
NPX80_RS24735 (NPX80_24740) 20272..20523 + 252 WP_001230707.1 hypothetical protein Toxin
NPX80_RS24740 (NPX80_24745) 20510..20737 + 228 WP_000801440.1 hypothetical protein Antitoxin
NPX80_RS24745 (NPX80_24750) 21191..21490 + 300 WP_256500690.1 hypothetical protein -
NPX80_RS24750 (NPX80_24755) 21581..21931 + 351 WP_000854259.1 hypothetical protein -
NPX80_RS24755 (NPX80_24760) 22236..22484 + 249 WP_000520549.1 type II toxin-antitoxin system HicA family toxin -
NPX80_RS24760 (NPX80_24765) 22481..22828 + 348 WP_000681613.1 type II toxin-antitoxin system HicB family antitoxin -
NPX80_RS24765 (NPX80_24770) 23189..23692 + 504 WP_000781813.1 relaxosome-coupling protein TaxA -
NPX80_RS24770 (NPX80_24775) 23696..24925 + 1230 WP_001329504.1 DNA relaxase/nickase TaxC -
NPX80_RS24775 (NPX80_24780) 25002..25295 + 294 WP_060598542.1 sigma factor-like helix-turn-helix DNA-binding protein -
NPX80_RS24780 (NPX80_24785) 25292..25507 + 216 WP_000760375.1 EexN family lipoprotein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid mcr-1.1 - 1..33309 33309


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 84 a.a.        Molecular weight: 9751.13 Da        Isoelectric Point: 8.9187

>T252802 WP_001230707.1 NZ_CP101861:20272-20523 [Escherichia coli]
MRKNKGDVTYFLEKEGDNYRLTKRIKARTNVKIGNKTTKITLYDAVLNENELQHIDFTCAGLREDDETPVKNLIKEFMLN
ETR

Download         Length: 252 bp

Antitoxin


Download         Length: 76 a.a.        Molecular weight: 8659.98 Da        Isoelectric Point: 8.5105

>AT252802 WP_000801440.1 NZ_CP101861:20510-20737 [Escherichia coli]
MKPDNTPENVKKLRLKAGLTQKECSHIYGVGLRTWQKKEEVNTQNSQSLSLVEFEFLLLLAGEHPEYVLCKRESK

Download         Length: 228 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB U9ZUY2

Antitoxin

Source ID Structure
AlphaFold DB A0A5Y6U8W9

References