Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-DnaT
Location 78999..79521 Replicon plasmid pLP50-1-87kb
Accession NZ_CP101860
Organism Escherichia coli strain LP50-1

Toxin (Protein)


Gene name relE Uniprot ID U9YLU1
Locus tag NPX80_RS24540 Protein ID WP_000638823.1
Coordinates 78999..79280 (-) Length 94 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID U9Y7J1
Locus tag NPX80_RS24545 Protein ID WP_000121741.1
Coordinates 79270..79521 (-) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NPX80_RS24505 (NPX80_24510) 75148..75468 - 321 WP_000362080.1 VirB3 family type IV secretion system protein -
NPX80_RS24510 (NPX80_24515) 75539..75829 - 291 WP_000865479.1 conjugal transfer protein -
NPX80_RS24515 (NPX80_24520) 75829..76413 - 585 WP_001177113.1 lytic transglycosylase domain-containing protein -
NPX80_RS24520 (NPX80_24525) 76434..76832 - 399 WP_001153665.1 hypothetical protein -
NPX80_RS24525 (NPX80_24530) 76951..77388 - 438 WP_000539665.1 type IV pilus biogenesis protein PilM -
NPX80_RS24530 (NPX80_24535) 77394..78629 - 1236 WP_015059538.1 TcpQ domain-containing protein -
NPX80_RS24535 (NPX80_24540) 78632..78931 - 300 WP_000835764.1 TrbM/KikA/MpfK family conjugal transfer protein -
NPX80_RS24540 (NPX80_24545) 78999..79280 - 282 WP_000638823.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NPX80_RS24545 (NPX80_24550) 79270..79521 - 252 WP_000121741.1 hypothetical protein Antitoxin
NPX80_RS24550 (NPX80_24555) 79621..80256 - 636 WP_015059536.1 hypothetical protein -
NPX80_RS24555 (NPX80_24560) 80329..80616 - 288 WP_001032611.1 EexN family lipoprotein -
NPX80_RS24560 (NPX80_24565) 80629..80883 - 255 WP_001043555.1 EexN family lipoprotein -
NPX80_RS24565 (NPX80_24570) 80885..81526 - 642 WP_001425343.1 type IV secretion system protein -
NPX80_RS24570 (NPX80_24575) 81532..82527 - 996 WP_001028543.1 type IV secretion system protein -
NPX80_RS24575 (NPX80_24580) 82531..82788 - 258 WP_000739144.1 hypothetical protein -
NPX80_RS24580 (NPX80_24585) 82785..83087 - 303 WP_001360345.1 hypothetical protein -
NPX80_RS24585 (NPX80_24590) 83068..83325 - 258 WP_001542015.1 hypothetical protein -
NPX80_RS24590 (NPX80_24595) 83358..83804 - 447 WP_001243165.1 hypothetical protein -
NPX80_RS24595 (NPX80_24600) 83815..83985 - 171 WP_000550720.1 hypothetical protein -
NPX80_RS24600 (NPX80_24605) 83989..84432 - 444 WP_000964330.1 NfeD family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - - 1..87554 87554


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-87)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 10945.79 Da        Isoelectric Point: 10.4997

>T252801 WP_000638823.1 NZ_CP101860:c79280-78999 [Escherichia coli]
MIYELAFDHRALKEWQKLGHTVREQFKKKLSERLINPRVPAAKLHGHTDRYKIKLRASGYRLVYQVIDEKVVLLVISVGK
REGSDVYHMADTR

Download         Length: 282 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9223.38 Da        Isoelectric Point: 3.9823

>AT252801 WP_000121741.1 NZ_CP101860:c79521-79270 [Escherichia coli]
MSYQILTTTAASITDLKKNPMGTVAEGEGDAVAILNRNEPAFYCVPPELYAYYRELAEDAELNAIADERMKNPDIVRVNL
DDL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB U9YLU1

Antitoxin

Source ID Structure
AlphaFold DB U9Y7J1

References