Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 4383256..4383874 | Replicon | chromosome |
Accession | NZ_CP101858 | ||
Organism | Escherichia coli strain LP50-1 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | NPX80_RS21175 | Protein ID | WP_001291435.1 |
Coordinates | 4383256..4383474 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | NPX80_RS21180 | Protein ID | WP_000344800.1 |
Coordinates | 4383500..4383874 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NPX80_RS21140 (4378545) | 4378545..4379117 | + | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
NPX80_RS21145 (4379148) | 4379148..4379459 | - | 312 | WP_000409911.1 | MGMT family protein | - |
NPX80_RS21155 (4379838) | 4379838..4380191 | + | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
NPX80_RS21160 (4380233) | 4380233..4381783 | - | 1551 | WP_001299455.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
NPX80_RS21165 (4381947) | 4381947..4382417 | - | 471 | WP_000136192.1 | YlaC family protein | - |
NPX80_RS21170 (4382533) | 4382533..4383084 | - | 552 | WP_000102568.1 | maltose O-acetyltransferase | - |
NPX80_RS21175 (4383256) | 4383256..4383474 | - | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
NPX80_RS21180 (4383500) | 4383500..4383874 | - | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
NPX80_RS21185 (4384420) | 4384420..4387569 | - | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
NPX80_RS21190 (4387592) | 4387592..4388785 | - | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T252793 WP_001291435.1 NZ_CP101858:c4383474-4383256 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT252793 WP_000344800.1 NZ_CP101858:c4383874-4383500 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |