Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
Location | 4348960..4349797 | Replicon | chromosome |
Accession | NZ_CP101858 | ||
Organism | Escherichia coli strain LP50-1 |
Toxin (Protein)
Gene name | itaT | Uniprot ID | Q3Z4X7 |
Locus tag | NPX80_RS21005 | Protein ID | WP_000227784.1 |
Coordinates | 4348960..4349502 (-) | Length | 181 a.a. |
Antitoxin (Protein)
Gene name | itaR | Uniprot ID | I2UQS9 |
Locus tag | NPX80_RS21010 | Protein ID | WP_001297137.1 |
Coordinates | 4349486..4349797 (-) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NPX80_RS20985 (4344499) | 4344499..4345410 | - | 912 | WP_000705847.1 | 2-dehydropantoate 2-reductase | - |
NPX80_RS20990 (4345578) | 4345578..4346069 | + | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
NPX80_RS20995 (4346197) | 4346197..4347561 | - | 1365 | WP_001000978.1 | MFS transporter | - |
NPX80_RS21000 (4347969) | 4347969..4348904 | + | 936 | WP_001297127.1 | tetratricopeptide repeat protein | - |
NPX80_RS21005 (4348960) | 4348960..4349502 | - | 543 | WP_000227784.1 | GNAT family N-acetyltransferase | Toxin |
NPX80_RS21010 (4349486) | 4349486..4349797 | - | 312 | WP_001297137.1 | DUF1778 domain-containing protein | Antitoxin |
NPX80_RS21015 (4349982) | 4349982..4350872 | - | 891 | WP_000971336.1 | heme o synthase | - |
NPX80_RS21020 (4350884) | 4350884..4351213 | - | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
NPX80_RS21025 (4351213) | 4351213..4351827 | - | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
NPX80_RS21030 (4351817) | 4351817..4353808 | - | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
NPX80_RS21035 (4353830) | 4353830..4354777 | - | 948 | WP_001239441.1 | cytochrome o ubiquinol oxidase subunit II | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19805.02 Da Isoelectric Point: 8.3395
>T252792 WP_000227784.1 NZ_CP101858:c4349502-4348960 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|