Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 2151583..2152237 | Replicon | chromosome |
| Accession | NZ_CP101858 | ||
| Organism | Escherichia coli strain LP50-1 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | F4NJ21 |
| Locus tag | NPX80_RS10450 | Protein ID | WP_000244772.1 |
| Coordinates | 2151583..2151990 (-) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | - |
| Locus tag | NPX80_RS10455 | Protein ID | WP_063100142.1 |
| Coordinates | 2151971..2152237 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NPX80_RS10430 (2147540) | 2147540..2149273 | - | 1734 | WP_000813215.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| NPX80_RS10435 (2149279) | 2149279..2149989 | - | 711 | WP_000715214.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| NPX80_RS10440 (2150014) | 2150014..2150910 | - | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
| NPX80_RS10445 (2151022) | 2151022..2151543 | + | 522 | WP_001055874.1 | flavodoxin FldB | - |
| NPX80_RS10450 (2151583) | 2151583..2151990 | - | 408 | WP_000244772.1 | protein YgfX | Toxin |
| NPX80_RS10455 (2151971) | 2151971..2152237 | - | 267 | WP_063100142.1 | FAD assembly factor SdhE | Antitoxin |
| NPX80_RS10460 (2152480) | 2152480..2153460 | + | 981 | WP_242808472.1 | tRNA-modifying protein YgfZ | - |
| NPX80_RS10465 (2153537) | 2153537..2154196 | - | 660 | WP_000250274.1 | hemolysin III family protein | - |
| NPX80_RS10470 (2154360) | 2154360..2154671 | - | 312 | WP_001182944.1 | N(4)-acetylcytidine aminohydrolase | - |
| NPX80_RS10475 (2154716) | 2154716..2156149 | + | 1434 | WP_001363803.1 | 6-phospho-beta-glucosidase BglA | - |
| NPX80_RS10480 (2156206) | 2156206..2156949 | - | 744 | WP_000951964.1 | SDR family oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16048.02 Da Isoelectric Point: 11.2511
>T252784 WP_000244772.1 NZ_CP101858:c2151990-2151583 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWCIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWCIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|