Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 1716285..1716910 | Replicon | chromosome |
Accession | NZ_CP101858 | ||
Organism | Escherichia coli strain LP50-1 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | NPX80_RS08370 | Protein ID | WP_000911330.1 |
Coordinates | 1716285..1716683 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | U9XQV3 |
Locus tag | NPX80_RS08375 | Protein ID | WP_000450524.1 |
Coordinates | 1716683..1716910 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NPX80_RS08350 (1712163) | 1712163..1712363 | + | 201 | WP_000383836.1 | YpfN family protein | - |
NPX80_RS08355 (1712473) | 1712473..1713171 | - | 699 | WP_000679823.1 | esterase | - |
NPX80_RS08360 (1713245) | 1713245..1715260 | - | 2016 | WP_000829329.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
NPX80_RS08365 (1715275) | 1715275..1716138 | - | 864 | WP_001267508.1 | neutral zinc metallopeptidase | - |
NPX80_RS08370 (1716285) | 1716285..1716683 | - | 399 | WP_000911330.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NPX80_RS08375 (1716683) | 1716683..1716910 | - | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
NPX80_RS08380 (1717064) | 1717064..1717777 | - | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
NPX80_RS08385 (1717990) | 1717990..1719024 | - | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
NPX80_RS08390 (1719041) | 1719041..1719919 | - | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
NPX80_RS08395 (1720065) | 1720065..1720637 | + | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
NPX80_RS08400 (1720637) | 1720637..1721107 | + | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14894.25 Da Isoelectric Point: 9.2216
>T252782 WP_000911330.1 NZ_CP101858:c1716683-1716285 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|