Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 554388..555026 | Replicon | chromosome |
| Accession | NZ_CP101858 | ||
| Organism | Escherichia coli strain LP50-1 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S1F9G9 |
| Locus tag | NPX80_RS02785 | Protein ID | WP_000813794.1 |
| Coordinates | 554388..554564 (+) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | NPX80_RS02790 | Protein ID | WP_001270286.1 |
| Coordinates | 554610..555026 (+) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NPX80_RS02765 (550007) | 550007..551182 | - | 1176 | WP_001236319.1 | BenE family transporter YdcO | - |
| NPX80_RS02770 (551274) | 551274..551810 | + | 537 | WP_000429141.1 | DNA-binding transcriptional regulator SutR | - |
| NPX80_RS02775 (551883) | 551883..553844 | + | 1962 | WP_001307191.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| NPX80_RS02780 (553936) | 553936..554166 | - | 231 | WP_000494244.1 | YncJ family protein | - |
| NPX80_RS02785 (554388) | 554388..554564 | + | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| NPX80_RS02790 (554610) | 554610..555026 | + | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| NPX80_RS02795 (555105) | 555105..556511 | + | 1407 | WP_000760629.1 | PLP-dependent aminotransferase family protein | - |
| NPX80_RS02800 (556756) | 556756..557901 | + | 1146 | WP_000047456.1 | ABC transporter substrate-binding protein | - |
| NPX80_RS02805 (557919) | 557919..558932 | + | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
| NPX80_RS02810 (558933) | 558933..559874 | + | 942 | WP_001251319.1 | ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 548702..549967 | 1265 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T252774 WP_000813794.1 NZ_CP101858:554388-554564 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT252774 WP_001270286.1 NZ_CP101858:554610-555026 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|