Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE(toxin)
Location 1194670..1195153 Replicon chromosome
Accession NZ_CP101844
Organism Streptococcus suis strain 2018WUSS151

Toxin (Protein)


Gene name relE Uniprot ID A0A0Z8BIZ7
Locus tag NOV99_RS06050 Protein ID WP_009910443.1
Coordinates 1194670..1194930 (-) Length 87 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A0Z8BIX7
Locus tag NOV99_RS06055 Protein ID WP_012775256.1
Coordinates 1194932..1195153 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NOV99_RS06025 (NOV99_06025) 1190055..1191284 - 1230 WP_044769950.1 tetratricopeptide repeat protein -
NOV99_RS06030 (NOV99_06030) 1191274..1192440 - 1167 WP_012775254.1 AI-2E family transporter -
NOV99_RS06035 (NOV99_06035) 1192576..1193580 + 1005 WP_024402853.1 lactonase family protein -
NOV99_RS06040 (NOV99_06040) 1193644..1193829 + 186 WP_002935693.1 hypothetical protein -
NOV99_RS06045 (NOV99_06045) 1193862..1194503 - 642 WP_024413325.1 HAD family hydrolase -
NOV99_RS06050 (NOV99_06050) 1194670..1194930 - 261 WP_009910443.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NOV99_RS06055 (NOV99_06055) 1194932..1195153 - 222 WP_012775256.1 DUF6290 family protein Antitoxin
NOV99_RS06060 (NOV99_06060) 1195463..1196770 - 1308 WP_002935704.1 phosphopyruvate hydratase -
NOV99_RS06065 (NOV99_06065) 1196920..1197408 + 489 WP_256527558.1 DUF1694 domain-containing protein -
NOV99_RS06070 (NOV99_06070) 1197824..1198078 - 255 WP_256527559.1 glycerate kinase -
NOV99_RS06075 (NOV99_06075) 1198087..1198374 - 288 WP_256527560.1 glycerate kinase -
NOV99_RS06080 (NOV99_06080) 1198322..1198435 - 114 WP_256527561.1 glycerate kinase -
NOV99_RS06085 (NOV99_06085) 1198488..1198673 - 186 WP_256528321.1 glycerate kinase -
NOV99_RS06090 (NOV99_06090) 1198673..1198786 - 114 WP_256527562.1 glycerate kinase -
NOV99_RS06095 (NOV99_06095) 1198894..1199544 + 651 WP_002935722.1 HAD family hydrolase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-86)

Antitoxin

Protein of unknown function DUF6290

(1-71)


Sequences

Toxin        


Download         Length: 87 a.a.        Molecular weight: 10270.78 Da        Isoelectric Point: 9.6925

>T252761 WP_009910443.1 NZ_CP101844:c1194930-1194670 [Streptococcus suis]
MYHLEYSKKAQKQIKKLDRQIQRLLFAWIDKHLEGTDNPRANGKGLTGNHANEWRYRIGDYRLICDIQDDKLVILALEFG
HRKDVY

Download         Length: 261 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8566.55 Da        Isoelectric Point: 4.4791

>AT252761 WP_012775256.1 NZ_CP101844:c1195153-1194932 [Streptococcus suis]
MSTVTIRLNQEEEVFFKSYAQLTGQSLSSLFKKALERDIEDEYDLKIYHQAYDEYKADPETISHADFKKELGL

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0Z8BIZ7

Antitoxin

Source ID Structure
AlphaFold DB A0A0Z8BIX7

References