Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE(toxin)
Location 866616..867102 Replicon chromosome
Accession NZ_CP101844
Organism Streptococcus suis strain 2018WUSS151

Toxin (Protein)


Gene name relE Uniprot ID A0A0K2E5U8
Locus tag NOV99_RS04350 Protein ID WP_002935012.1
Coordinates 866845..867102 (+) Length 86 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A0K2E5B0
Locus tag NOV99_RS04345 Protein ID WP_002935014.1
Coordinates 866616..866855 (+) Length 80 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NOV99_RS04315 (NOV99_04315) 862265..862402 + 138 WP_002935027.1 hypothetical protein -
NOV99_RS04320 (NOV99_04320) 862415..863149 + 735 WP_002935025.1 TraX family protein -
NOV99_RS04325 (NOV99_04325) 863248..863388 + 141 WP_002935023.1 hypothetical protein -
NOV99_RS04330 (NOV99_04330) 863401..863784 + 384 WP_002935021.1 NisI/SpaI family lantibiotic immunity lipoprotein -
NOV99_RS04335 (NOV99_04335) 863801..864553 + 753 WP_002935019.1 ABC transporter ATP-binding protein -
NOV99_RS04340 (NOV99_04340) 864554..866524 + 1971 WP_013730363.1 FtsX-like permease family protein -
NOV99_RS04345 (NOV99_04345) 866616..866855 + 240 WP_002935014.1 DUF6290 family protein Antitoxin
NOV99_RS04350 (NOV99_04350) 866845..867102 + 258 WP_002935012.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NOV99_RS04355 (NOV99_04355) 867141..867806 + 666 WP_009909826.1 response regulator transcription factor -
NOV99_RS04360 (NOV99_04360) 867803..868744 + 942 WP_002935009.1 sensor histidine kinase -
NOV99_RS04365 (NOV99_04365) 868820..870328 + 1509 WP_240016552.1 phosphomannomutase/phosphoglucomutase -
NOV99_RS04370 (NOV99_04370) 870398..871468 - 1071 WP_240020571.1 tyrosine recombinase XerS -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-75)

Antitoxin

Protein of unknown function DUF6290

(1-74)


Sequences

Toxin        


Download         Length: 86 a.a.        Molecular weight: 9849.52 Da        Isoelectric Point: 10.7134

>T252760 WP_002935012.1 NZ_CP101844:866845-867102 [Streptococcus suis]
MSYKVILSAKAQKQIRKMDKTAASLILRYLYKHIDGCDNPRQYGKALTANRSGQWRYRIGNYRVIVNIEDDKLIVTSIKM
RNGSI

Download         Length: 258 bp

Antitoxin


Download         Length: 80 a.a.        Molecular weight: 8924.19 Da        Isoelectric Point: 3.9191

>AT252760 WP_002935014.1 NZ_CP101844:866616-866855 [Streptococcus suis]
MAAITLKVSEQDKLFMQAMAKFEGVSLSELIRTKTLEALEDEYDARVADVAWAEYQADLANRIEPMTLEQMAEELGIEL

Download         Length: 240 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0K2E5U8

Antitoxin

Source ID Structure
AlphaFold DB A0A0K2E5B0

References