Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 20613..21256 Replicon plasmid pGN4549-3
Accession NZ_CP101838
Organism Klebsiella pneumoniae strain GN4549

Toxin (Protein)


Gene name vagD Uniprot ID Q84A06
Locus tag NPH93_RS27860 Protein ID WP_000754566.1
Coordinates 20613..21029 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q84A07
Locus tag NPH93_RS27865 Protein ID WP_001261276.1
Coordinates 21026..21256 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NPH93_RS27835 (NPH93_27820) 16015..16719 - 705 WP_004228310.1 IS6-like element IS26 family transposase -
NPH93_RS27840 (NPH93_27825) 16787..17308 + 522 Protein_20 Tn3 family transposase -
NPH93_RS27845 (NPH93_27830) 17471..17554 - 84 Protein_21 SOS response-associated peptidase -
NPH93_RS27850 (NPH93_27835) 18195..19271 - 1077 WP_000227969.1 IS110 family transposase -
NPH93_RS27855 (NPH93_27840) 19553..20409 - 857 Protein_23 IS3-like element ISEc15 family transposase -
NPH93_RS27860 (NPH93_27845) 20613..21029 - 417 WP_000754566.1 type II toxin-antitoxin system VapC family toxin Toxin
NPH93_RS27865 (NPH93_27850) 21026..21256 - 231 WP_001261276.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
NPH93_RS27870 (NPH93_27855) 21830..22180 + 351 WP_000493378.1 hypothetical protein -
NPH93_RS27875 (NPH93_27860) 22231..22974 + 744 WP_000129823.1 hypothetical protein -
NPH93_RS27880 (NPH93_27865) 22971..23747 + 777 WP_000015958.1 site-specific integrase -
NPH93_RS27885 (NPH93_27870) 23805..24062 - 258 WP_000764642.1 hypothetical protein -
NPH93_RS27890 (NPH93_27875) 24191..24295 - 105 WP_032409716.1 hypothetical protein -
NPH93_RS27895 (NPH93_27880) 24825..25691 + 867 WP_004118283.1 replication initiation protein -
NPH93_RS27900 (NPH93_27885) 25868..26137 - 270 WP_000339857.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid aac(6')-Ib-cr / blaOXA-1 / catB3 / ARR-3 / qacE / sul1 / mph(A) - 1..38758 38758


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15006.52 Da        Isoelectric Point: 9.2957

>T252758 WP_000754566.1 NZ_CP101838:c21029-20613 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAVLPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNVREFARVPGLVLEDWVK

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8721.74 Da        Isoelectric Point: 4.3533

>AT252758 WP_001261276.1 NZ_CP101838:c21256-21026 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRADPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A387K1G3

Antitoxin

Source ID Structure
AlphaFold DB A0A387K023

References