Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 20613..21256 | Replicon | plasmid pGN4549-3 |
| Accession | NZ_CP101838 | ||
| Organism | Klebsiella pneumoniae strain GN4549 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | Q84A06 |
| Locus tag | NPH93_RS27860 | Protein ID | WP_000754566.1 |
| Coordinates | 20613..21029 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | Q84A07 |
| Locus tag | NPH93_RS27865 | Protein ID | WP_001261276.1 |
| Coordinates | 21026..21256 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NPH93_RS27835 (NPH93_27820) | 16015..16719 | - | 705 | WP_004228310.1 | IS6-like element IS26 family transposase | - |
| NPH93_RS27840 (NPH93_27825) | 16787..17308 | + | 522 | Protein_20 | Tn3 family transposase | - |
| NPH93_RS27845 (NPH93_27830) | 17471..17554 | - | 84 | Protein_21 | SOS response-associated peptidase | - |
| NPH93_RS27850 (NPH93_27835) | 18195..19271 | - | 1077 | WP_000227969.1 | IS110 family transposase | - |
| NPH93_RS27855 (NPH93_27840) | 19553..20409 | - | 857 | Protein_23 | IS3-like element ISEc15 family transposase | - |
| NPH93_RS27860 (NPH93_27845) | 20613..21029 | - | 417 | WP_000754566.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NPH93_RS27865 (NPH93_27850) | 21026..21256 | - | 231 | WP_001261276.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| NPH93_RS27870 (NPH93_27855) | 21830..22180 | + | 351 | WP_000493378.1 | hypothetical protein | - |
| NPH93_RS27875 (NPH93_27860) | 22231..22974 | + | 744 | WP_000129823.1 | hypothetical protein | - |
| NPH93_RS27880 (NPH93_27865) | 22971..23747 | + | 777 | WP_000015958.1 | site-specific integrase | - |
| NPH93_RS27885 (NPH93_27870) | 23805..24062 | - | 258 | WP_000764642.1 | hypothetical protein | - |
| NPH93_RS27890 (NPH93_27875) | 24191..24295 | - | 105 | WP_032409716.1 | hypothetical protein | - |
| NPH93_RS27895 (NPH93_27880) | 24825..25691 | + | 867 | WP_004118283.1 | replication initiation protein | - |
| NPH93_RS27900 (NPH93_27885) | 25868..26137 | - | 270 | WP_000339857.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | aac(6')-Ib-cr / blaOXA-1 / catB3 / ARR-3 / qacE / sul1 / mph(A) | - | 1..38758 | 38758 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15006.52 Da Isoelectric Point: 9.2957
>T252758 WP_000754566.1 NZ_CP101838:c21029-20613 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAVLPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNVREFARVPGLVLEDWVK
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAVLPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNVREFARVPGLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A387K1G3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A387K023 |