Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4072696..4073315 Replicon chromosome
Accession NZ_CP101835
Organism Klebsiella pneumoniae strain GN4549

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag NPH93_RS20140 Protein ID WP_002892050.1
Coordinates 4073097..4073315 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag NPH93_RS20135 Protein ID WP_002892066.1
Coordinates 4072696..4073070 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NPH93_RS20125 (NPH93_20120) 4067848..4069041 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
NPH93_RS20130 (NPH93_20125) 4069064..4072210 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
NPH93_RS20135 (NPH93_20130) 4072696..4073070 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
NPH93_RS20140 (NPH93_20135) 4073097..4073315 + 219 WP_002892050.1 HHA domain-containing protein Toxin
NPH93_RS20145 (NPH93_20140) 4073474..4074040 + 567 WP_002892030.1 maltose O-acetyltransferase -
NPH93_RS20150 (NPH93_20145) 4074012..4074152 - 141 WP_004147370.1 hypothetical protein -
NPH93_RS20155 (NPH93_20150) 4074173..4074643 + 471 WP_002892026.1 YlaC family protein -
NPH93_RS20160 (NPH93_20155) 4074618..4076069 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
NPH93_RS20165 (NPH93_20160) 4076170..4076868 + 699 WP_002892021.1 GNAT family protein -
NPH93_RS20170 (NPH93_20165) 4076865..4077005 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
NPH93_RS20175 (NPH93_20170) 4077005..4077268 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T252752 WP_002892050.1 NZ_CP101835:4073097-4073315 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT252752 WP_002892066.1 NZ_CP101835:4072696-4073070 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References