Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 68653..69245 | Replicon | plasmid unnamed |
Accession | NZ_CP101834 | ||
Organism | Bacillus pumilus strain NDY-10 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | NPA43_RS19050 | Protein ID | WP_106031820.1 |
Coordinates | 68653..68976 (-) | Length | 108 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | NPA43_RS19055 | Protein ID | WP_106031819.1 |
Coordinates | 68976..69245 (-) | Length | 90 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NPA43_RS19020 (NPA43_19020) | 64667..64939 | - | 273 | WP_106031826.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
NPA43_RS19025 (NPA43_19025) | 65032..65361 | - | 330 | WP_256499719.1 | hypothetical protein | - |
NPA43_RS19030 (NPA43_19030) | 65386..66453 | - | 1068 | WP_256499720.1 | hypothetical protein | - |
NPA43_RS19035 (NPA43_19035) | 66573..67142 | - | 570 | WP_106031823.1 | hypothetical protein | - |
NPA43_RS19040 (NPA43_19040) | 67129..67560 | - | 432 | WP_106031822.1 | hypothetical protein | - |
NPA43_RS19045 (NPA43_19045) | 67825..68463 | - | 639 | WP_142393584.1 | hypothetical protein | - |
NPA43_RS19050 (NPA43_19050) | 68653..68976 | - | 324 | WP_106031820.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
NPA43_RS19055 (NPA43_19055) | 68976..69245 | - | 270 | WP_106031819.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
NPA43_RS19060 (NPA43_19060) | 69355..69741 | - | 387 | WP_106031818.1 | hypothetical protein | - |
NPA43_RS19065 (NPA43_19065) | 69752..70954 | - | 1203 | WP_106031817.1 | hypothetical protein | - |
NPA43_RS19070 (NPA43_19070) | 72195..72371 | + | 177 | WP_251181573.1 | hypothetical protein | - |
NPA43_RS19075 (NPA43_19075) | 72478..73587 | + | 1110 | WP_106031815.1 | tetratricopeptide repeat protein | - |
NPA43_RS19080 (NPA43_19080) | 73805..74191 | - | 387 | WP_106031814.1 | helix-turn-helix transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..85178 | 85178 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 108 a.a. Molecular weight: 11915.74 Da Isoelectric Point: 7.1320
>T252742 WP_106031820.1 NZ_CP101834:c68976-68653 [Bacillus pumilus]
MSFDKGDLVYVQFTPQAGHEQAGRRPAIVLSPKNFNEITGFAVVCPITSKKKGYPFEVALPDGLAIQGVILTDQIKSLDW
KARSFQFKDTAPETIITECLDKIHTYL
MSFDKGDLVYVQFTPQAGHEQAGRRPAIVLSPKNFNEITGFAVVCPITSKKKGYPFEVALPDGLAIQGVILTDQIKSLDW
KARSFQFKDTAPETIITECLDKIHTYL
Download Length: 324 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|