Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 519944..520580 | Replicon | chromosome |
Accession | NZ_CP101833 | ||
Organism | Bacillus pumilus strain NDY-10 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | K2MHT4 |
Locus tag | NPA43_RS02535 | Protein ID | WP_003214169.1 |
Coordinates | 520230..520580 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | W8QJ31 |
Locus tag | NPA43_RS02530 | Protein ID | WP_003214273.1 |
Coordinates | 519944..520225 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NPA43_RS02510 (NPA43_02510) | 516089..516694 | - | 606 | WP_099728420.1 | rhomboid family intramembrane serine protease | - |
NPA43_RS02515 (NPA43_02515) | 516789..517154 | + | 366 | WP_256499323.1 | holo-ACP synthase | - |
NPA43_RS02520 (NPA43_02520) | 517315..518331 | + | 1017 | WP_099728418.1 | outer membrane lipoprotein carrier protein LolA | - |
NPA43_RS02525 (NPA43_02525) | 518471..519652 | + | 1182 | WP_099728417.1 | alanine racemase | - |
NPA43_RS02530 (NPA43_02530) | 519944..520225 | + | 282 | WP_003214273.1 | hypothetical protein | Antitoxin |
NPA43_RS02535 (NPA43_02535) | 520230..520580 | + | 351 | WP_003214169.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
NPA43_RS02540 (NPA43_02540) | 520698..521528 | + | 831 | WP_099728416.1 | RsbT co-antagonist protein RsbRA | - |
NPA43_RS02545 (NPA43_02545) | 521533..521901 | + | 369 | WP_003214235.1 | RsbT antagonist protein RsbS | - |
NPA43_RS02550 (NPA43_02550) | 521904..522305 | + | 402 | WP_256499324.1 | anti-sigma regulatory factor | - |
NPA43_RS02555 (NPA43_02555) | 522316..523323 | + | 1008 | WP_230031323.1 | PP2C family protein-serine/threonine phosphatase | - |
NPA43_RS02560 (NPA43_02560) | 523383..523712 | + | 330 | WP_099728413.1 | anti-sigma factor antagonist | - |
NPA43_RS02565 (NPA43_02565) | 523709..524197 | + | 489 | WP_230031324.1 | anti-sigma B factor RsbW | - |
NPA43_RS02570 (NPA43_02570) | 524163..524951 | + | 789 | WP_099728411.1 | RNA polymerase sigma factor SigB | - |
NPA43_RS02575 (NPA43_02575) | 524951..525550 | + | 600 | WP_099728410.1 | PP2C family serine/threonine-protein phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12976.99 Da Isoelectric Point: 5.1663
>T252741 WP_003214169.1 NZ_CP101833:520230-520580 [Bacillus pumilus]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEINAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVDEALQVSLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEINAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVDEALQVSLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | K2MHT4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A081L854 |