Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/MazF(toxin) |
Location | 2711684..2712335 | Replicon | chromosome |
Accession | NZ_CP101831 | ||
Organism | Lacticaseibacillus paracasei strain SMN-LBK |
Toxin (Protein)
Gene name | pemK | Uniprot ID | K6S8L5 |
Locus tag | NPC72_RS13085 | Protein ID | WP_003567661.1 |
Coordinates | 2711684..2712067 (-) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | K6RKI5 |
Locus tag | NPC72_RS13090 | Protein ID | WP_003567665.1 |
Coordinates | 2712087..2712335 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NPC72_RS13080 (NPC72_13080) | 2710979..2711500 | - | 522 | WP_003567657.1 | QueT transporter family protein | - |
NPC72_RS13085 (NPC72_13085) | 2711684..2712067 | - | 384 | WP_003567661.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
NPC72_RS13090 (NPC72_13090) | 2712087..2712335 | - | 249 | WP_003567665.1 | antitoxin | Antitoxin |
NPC72_RS13095 (NPC72_13095) | 2712403..2713539 | - | 1137 | WP_003581082.1 | alanine racemase | - |
NPC72_RS13100 (NPC72_13100) | 2713526..2713900 | - | 375 | WP_003567669.1 | holo-ACP synthase | - |
NPC72_RS13105 (NPC72_13105) | 2714070..2715578 | - | 1509 | WP_003567670.1 | DEAD/DEAH box helicase | - |
NPC72_RS13110 (NPC72_13110) | 2715704..2715847 | - | 144 | WP_003588978.1 | hypothetical protein | - |
NPC72_RS13115 (NPC72_13115) | 2715878..2717266 | - | 1389 | WP_003567677.1 | UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D- alanine ligase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 13773.03 Da Isoelectric Point: 10.9764
>T252740 WP_003567661.1 NZ_CP101831:c2712067-2711684 [Lacticaseibacillus paracasei]
MDVSVKRGDVFFADLSPVVGSEQGGNRPVLIIQNNVGNHYSPTVIVAAITSKIQKPKMPTHVGLRAKQDGVERNSVILLE
QIRTIDKQRLQARVTALSSTKMAAVDRALAISVGLVSLPKPKTYNKN
MDVSVKRGDVFFADLSPVVGSEQGGNRPVLIIQNNVGNHYSPTVIVAAITSKIQKPKMPTHVGLRAKQDGVERNSVILLE
QIRTIDKQRLQARVTALSSTKMAAVDRALAISVGLVSLPKPKTYNKN
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | K6S8L5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E2BNY2 |