Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 27911..28436 | Replicon | plasmid unnamed5 |
Accession | NZ_CP101795 | ||
Organism | Klebsiella pneumoniae strain hvKP859 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | D4HQE7 |
Locus tag | NPJ86_RS28030 | Protein ID | WP_013023785.1 |
Coordinates | 28131..28436 (+) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | W8V2V6 |
Locus tag | NPJ86_RS28025 | Protein ID | WP_001568025.1 |
Coordinates | 27911..28129 (+) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NPJ86_RS28005 (NPJ86_28005) | 23067..23846 | + | 780 | WP_013023780.1 | hypothetical protein | - |
NPJ86_RS28010 (NPJ86_28010) | 24053..25645 | + | 1593 | WP_015344964.1 | hypothetical protein | - |
NPJ86_RS28015 (NPJ86_28015) | 25679..26806 | + | 1128 | WP_013023782.1 | DUF4238 domain-containing protein | - |
NPJ86_RS28020 (NPJ86_28020) | 26803..27093 | + | 291 | WP_013023783.1 | hypothetical protein | - |
NPJ86_RS28025 (NPJ86_28025) | 27911..28129 | + | 219 | WP_001568025.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
NPJ86_RS28030 (NPJ86_28030) | 28131..28436 | + | 306 | WP_013023785.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
NPJ86_RS28035 (NPJ86_28035) | 28605..29000 | + | 396 | WP_017899885.1 | hypothetical protein | - |
NPJ86_RS28040 (NPJ86_28040) | 29027..29341 | + | 315 | WP_053389906.1 | hypothetical protein | - |
NPJ86_RS28045 (NPJ86_28045) | 29352..30368 | + | 1017 | WP_017899884.1 | hypothetical protein | - |
NPJ86_RS28050 (NPJ86_28050) | 30566..31360 | + | 795 | WP_004197635.1 | site-specific integrase | - |
NPJ86_RS28055 (NPJ86_28055) | 31784..32086 | - | 303 | WP_004197636.1 | hypothetical protein | - |
NPJ86_RS28060 (NPJ86_28060) | 32083..32709 | - | 627 | WP_004197649.1 | ParA family plasmid-partitioning AAA ATPase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | blaCTX-M-15 / blaTEM-1B | - | 1..95527 | 95527 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11615.30 Da Isoelectric Point: 6.4672
>T252737 WP_013023785.1 NZ_CP101795:28131-28436 [Klebsiella pneumoniae]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESYRLMTTDMASVTSSVTGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESYRLMTTDMASVTSSVTGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2J4ZZW6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2J4ZZP8 |