Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ataRT/ElaA-DUF1778 |
Location | 181995..182746 | Replicon | plasmid unnamed4 |
Accession | NZ_CP101794 | ||
Organism | Klebsiella pneumoniae strain hvKP859 |
Toxin (Protein)
Gene name | ataT | Uniprot ID | - |
Locus tag | NPJ86_RS27685 | Protein ID | WP_048333033.1 |
Coordinates | 181995..182477 (-) | Length | 161 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | A0A071LPN3 |
Locus tag | NPJ86_RS27690 | Protein ID | WP_004902250.1 |
Coordinates | 182468..182746 (-) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NPJ86_RS27665 (NPJ86_27665) | 178394..179041 | - | 648 | WP_014386537.1 | EcsC family protein | - |
NPJ86_RS27670 (NPJ86_27670) | 179068..179823 | - | 756 | WP_004902235.1 | DUF2971 domain-containing protein | - |
NPJ86_RS27675 (NPJ86_27675) | 179924..180316 | - | 393 | WP_123812462.1 | hypothetical protein | - |
NPJ86_RS27680 (NPJ86_27680) | 180421..180960 | - | 540 | WP_004902239.1 | hypothetical protein | - |
NPJ86_RS27685 (NPJ86_27685) | 181995..182477 | - | 483 | WP_048333033.1 | GNAT family N-acetyltransferase | Toxin |
NPJ86_RS27690 (NPJ86_27690) | 182468..182746 | - | 279 | WP_004902250.1 | DUF1778 domain-containing protein | Antitoxin |
NPJ86_RS27695 (NPJ86_27695) | 182868..183080 | - | 213 | WP_016946198.1 | hypothetical protein | - |
NPJ86_RS27700 (NPJ86_27700) | 183188..183529 | - | 342 | WP_032437747.1 | hypothetical protein | - |
NPJ86_RS27705 (NPJ86_27705) | 184434..184748 | + | 315 | WP_023288299.1 | hypothetical protein | - |
NPJ86_RS27710 (NPJ86_27710) | 184992..185474 | - | 483 | WP_172694439.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | - | iroB / iroC / iroD / iroN / rmpA / iucA / iucB / iucC / iucD / iutA / rmpA | 1..212541 | 212541 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17708.53 Da Isoelectric Point: 8.9130
>T252736 WP_048333033.1 NZ_CP101794:c182477-181995 [Klebsiella pneumoniae]
MGMRAPESLMSEHNIAEFCCQEPALNEWLKKKALRNHSTGISRVYVVCAENTNRVIGYYCLSSGSVHRNTVPGAYRRNAP
DVIPVIVLGRLAIDQAWAGNGLGAALLKDAIYRTQNIAFQVGVRALAVHALNEEVKCFYTRFGFEPSIVNTLTLLFPIKV
MGMRAPESLMSEHNIAEFCCQEPALNEWLKKKALRNHSTGISRVYVVCAENTNRVIGYYCLSSGSVHRNTVPGAYRRNAP
DVIPVIVLGRLAIDQAWAGNGLGAALLKDAIYRTQNIAFQVGVRALAVHALNEEVKCFYTRFGFEPSIVNTLTLLFPIKV
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|