Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 138518..139188 Replicon plasmid unnamed4
Accession NZ_CP101794
Organism Klebsiella pneumoniae strain hvKP859

Toxin (Protein)


Gene name vagD Uniprot ID Q6U619
Locus tag NPJ86_RS27460 Protein ID WP_004213072.1
Coordinates 138518..138961 (-) Length 148 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q6U620
Locus tag NPJ86_RS27465 Protein ID WP_004213073.1
Coordinates 138958..139188 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NPJ86_RS27425 (NPJ86_27425) 133927..134202 + 276 WP_004213932.1 carboxymuconolactone decarboxylase family protein -
NPJ86_RS27430 (NPJ86_27430) 134265..134756 + 492 WP_011251327.1 DM13 domain-containing protein -
NPJ86_RS27435 (NPJ86_27435) 134805..135725 + 921 WP_004213934.1 DUF1471 domain-containing protein -
NPJ86_RS27440 (NPJ86_27440) 135816..136219 + 404 Protein_149 GAF domain-containing protein -
NPJ86_RS27445 (NPJ86_27445) 136737..137374 - 638 Protein_150 mucoid phenotype regulator RmpA2 -
NPJ86_RS27450 (NPJ86_27450) 137791..138095 + 305 Protein_151 transposase -
NPJ86_RS27455 (NPJ86_27455) 138118..138369 - 252 WP_186987481.1 hypothetical protein -
NPJ86_RS27460 (NPJ86_27460) 138518..138961 - 444 WP_004213072.1 type II toxin-antitoxin system VapC family toxin Toxin
NPJ86_RS27465 (NPJ86_27465) 138958..139188 - 231 WP_004213073.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
NPJ86_RS27470 (NPJ86_27470) 139796..140929 + 1134 WP_004213075.1 DUF3800 domain-containing protein -
NPJ86_RS27475 (NPJ86_27475) 140945..141238 + 294 WP_004213076.1 hypothetical protein -
NPJ86_RS27480 (NPJ86_27480) 141228..141434 - 207 WP_004213077.1 hypothetical protein -
NPJ86_RS27485 (NPJ86_27485) 141786..142076 + 291 WP_004213078.1 hypothetical protein -
NPJ86_RS27490 (NPJ86_27490) 142066..142965 + 900 WP_004225022.1 nucleotide-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - iroB / iroC / iroD / iroN / rmpA / iucA / iucB / iucC / iucD / iutA / rmpA 1..212541 212541


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 148 a.a.        Molecular weight: 16006.74 Da        Isoelectric Point: 9.3642

>T252735 WP_004213072.1 NZ_CP101794:c138961-138518 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS

Download         Length: 444 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8677.73 Da        Isoelectric Point: 4.4563

>AT252735 WP_004213073.1 NZ_CP101794:c139188-138958 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRAAPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q6U619

Antitoxin

Source ID Structure
AlphaFold DB Q6U620

References