Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 46129..46865 | Replicon | plasmid unnamed4 |
| Accession | NZ_CP101794 | ||
| Organism | Klebsiella pneumoniae strain hvKP859 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | A0A2J5Q928 |
| Locus tag | NPJ86_RS26935 | Protein ID | WP_004098919.1 |
| Coordinates | 46383..46865 (+) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | A0A7D3T1D0 |
| Locus tag | NPJ86_RS26930 | Protein ID | WP_004213599.1 |
| Coordinates | 46129..46395 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NPJ86_RS26905 (NPJ86_26905) | 41361..41918 | + | 558 | WP_004213590.1 | recombinase family protein | - |
| NPJ86_RS26910 (NPJ86_26910) | 41921..44890 | + | 2970 | WP_004213592.1 | Tn3 family transposase | - |
| NPJ86_RS26915 (NPJ86_26915) | 44932..45426 | + | 495 | WP_004213594.1 | hypothetical protein | - |
| NPJ86_RS26920 (NPJ86_26920) | 45487..45690 | + | 204 | WP_004213596.1 | HHA domain-containing protein | - |
| NPJ86_RS26925 (NPJ86_26925) | 45704..45934 | + | 231 | WP_004213598.1 | hypothetical protein | - |
| NPJ86_RS26930 (NPJ86_26930) | 46129..46395 | + | 267 | WP_004213599.1 | DUF1778 domain-containing protein | Antitoxin |
| NPJ86_RS26935 (NPJ86_26935) | 46383..46865 | + | 483 | WP_004098919.1 | GNAT family N-acetyltransferase | Toxin |
| NPJ86_RS26940 (NPJ86_26940) | 47286..48513 | + | 1228 | Protein_49 | IS3 family transposase | - |
| NPJ86_RS26945 (NPJ86_26945) | 48509..48904 | - | 396 | Protein_50 | IS3 family transposase | - |
| NPJ86_RS26950 (NPJ86_26950) | 49079..50101 | - | 1023 | WP_004214536.1 | porphobilinogen synthase | - |
| NPJ86_RS26955 (NPJ86_26955) | 50165..51511 | - | 1347 | WP_048333011.1 | dihydroorotase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | - | iroB / iroC / iroD / iroN / rmpA / iucA / iucB / iucC / iucD / iutA / rmpA | 1..212541 | 212541 | |
| - | inside | IScluster/Tn | - | - | 41361..48513 | 7152 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17335.06 Da Isoelectric Point: 10.0704
>T252733 WP_004098919.1 NZ_CP101794:46383-46865 [Klebsiella pneumoniae]
VGRITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKKGTKKVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
VGRITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKKGTKKVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2J5Q928 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7D3T1D0 |