252732

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsxAB/Xre(antitoxin)
Location 12539..13040 Replicon plasmid unnamed3
Accession NZ_CP101793
Organism Klebsiella pneumoniae strain hvKP859

Toxin (Protein)


Gene name TsxA Uniprot ID A0A2S5RIK4
Locus tag NPJ86_RS26425 Protein ID WP_022645141.1
Coordinates 12780..13040 (-) Length 87 a.a.

Antitoxin (Protein)


Gene name TsxB Uniprot ID A0A2S5RIE4
Locus tag NPJ86_RS26420 Protein ID WP_022645142.1
Coordinates 12539..12790 (-) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NPJ86_RS26370 (NPJ86_26370) 7638..8345 + 708 WP_000108794.1 hypothetical protein -
NPJ86_RS26375 (NPJ86_26375) 8365..8838 + 474 WP_069904646.1 hypothetical protein -
NPJ86_RS26380 (NPJ86_26380) 8819..9013 + 195 WP_000224733.1 hypothetical protein -
NPJ86_RS26385 (NPJ86_26385) 9015..9212 + 198 WP_023225988.1 hypothetical protein -
NPJ86_RS26390 (NPJ86_26390) 9214..9477 + 264 WP_023225989.1 hypothetical protein -
NPJ86_RS26395 (NPJ86_26395) 9620..9805 + 186 Protein_13 hypothetical protein -
NPJ86_RS26400 (NPJ86_26400) 9939..10376 - 438 WP_000466318.1 type II toxin-antitoxin system HicB family antitoxin -
NPJ86_RS26405 (NPJ86_26405) 10401..10583 - 183 WP_000833470.1 type II toxin-antitoxin system HicA family toxin -
NPJ86_RS26410 (NPJ86_26410) 10880..11323 + 444 WP_235637039.1 hypothetical protein -
NPJ86_RS26415 (NPJ86_26415) 11711..11989 - 279 WP_000545937.1 hypothetical protein -
NPJ86_RS26420 (NPJ86_26420) 12539..12790 - 252 WP_022645142.1 transcriptional regulator Antitoxin
NPJ86_RS26425 (NPJ86_26425) 12780..13040 - 261 WP_022645141.1 hypothetical protein Toxin
NPJ86_RS26430 (NPJ86_26430) 13092..13316 - 225 WP_000814383.1 hypothetical protein -
NPJ86_RS26435 (NPJ86_26435) 13414..13623 - 210 WP_000866037.1 hypothetical protein -
NPJ86_RS26440 (NPJ86_26440) 13664..13987 - 324 WP_000427402.1 hypothetical protein -
NPJ86_RS26445 (NPJ86_26445) 14566..14895 - 330 WP_000855121.1 hypothetical protein -
NPJ86_RS26450 (NPJ86_26450) 15492..16157 + 666 WP_000532148.1 division plane positioning ATPase MipZ -
NPJ86_RS26455 (NPJ86_26455) 16231..16515 + 285 WP_001162371.1 hypothetical protein -
NPJ86_RS26460 (NPJ86_26460) 16533..17129 - 597 WP_000125164.1 ProQ/FINO family protein -
NPJ86_RS26465 (NPJ86_26465) 17279..17398 - 120 WP_227525580.1 Hok/Gef family protein -
NPJ86_RS26470 (NPJ86_26470) 17346..17498 - 153 Protein_28 FlmC family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - - 1..57327 57327


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Cro/C1-type helix-turn-helix domain

(8-37)


Sequences

Toxin        


Download         Length: 87 a.a.        Molecular weight: 9876.23 Da        Isoelectric Point: 7.2030

>T252732 WP_022645141.1 NZ_CP101793:c13040-12780 [Klebsiella pneumoniae]
MKIRKGDRQYYLNKEGDTFHLVKRVKTFSKSATLGKTKATVKTVADLVFHEEAFDTIDFASDGLRENDKEIVSMMIQEMS
EEKNAN

Download         Length: 261 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9407.81 Da        Isoelectric Point: 9.8120

>AT252732 WP_022645142.1 NZ_CP101793:c12790-12539 [Klebsiella pneumoniae]
MLTENTPENIKRLRQKIGLTQKECAEIFSMSPRTWRRKEEPVGTASGTALTPVEFKFLLLLAGEHPDYVLCKRNKKNSDS
GSN

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2S5RIK4

Antitoxin

Source ID Structure
AlphaFold DB A0A2S5RIE4

References