Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 5183200..5183825 | Replicon | chromosome |
Accession | NZ_CP101790 | ||
Organism | Klebsiella pneumoniae strain hvKP859 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | R4Y4A3 |
Locus tag | NPJ86_RS25220 | Protein ID | WP_002882817.1 |
Coordinates | 5183200..5183583 (-) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | J2DFR0 |
Locus tag | NPJ86_RS25225 | Protein ID | WP_004150355.1 |
Coordinates | 5183583..5183825 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NPJ86_RS25205 (NPJ86_25205) | 5180566..5181468 | + | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
NPJ86_RS25210 (NPJ86_25210) | 5181465..5182100 | + | 636 | WP_002882818.1 | formate dehydrogenase cytochrome b556 subunit | - |
NPJ86_RS25215 (NPJ86_25215) | 5182097..5183026 | + | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
NPJ86_RS25220 (NPJ86_25220) | 5183200..5183583 | - | 384 | WP_002882817.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NPJ86_RS25225 (NPJ86_25225) | 5183583..5183825 | - | 243 | WP_004150355.1 | CopG family transcriptional regulator | Antitoxin |
NPJ86_RS25230 (NPJ86_25230) | 5184030..5184947 | + | 918 | WP_021466676.1 | alpha/beta hydrolase | - |
NPJ86_RS25235 (NPJ86_25235) | 5184961..5185902 | - | 942 | WP_073558103.1 | fatty acid biosynthesis protein FabY | - |
NPJ86_RS25240 (NPJ86_25240) | 5185947..5186384 | - | 438 | WP_002882809.1 | D-aminoacyl-tRNA deacylase | - |
NPJ86_RS25245 (NPJ86_25245) | 5186381..5187241 | - | 861 | WP_004146232.1 | virulence factor BrkB family protein | - |
NPJ86_RS25250 (NPJ86_25250) | 5187235..5187834 | - | 600 | WP_004151865.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14377.62 Da Isoelectric Point: 7.3178
>T252731 WP_002882817.1 NZ_CP101790:c5183583-5183200 [Klebsiella pneumoniae]
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GPK8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GGU9 |