Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4696350..4696866 | Replicon | chromosome |
| Accession | NZ_CP101790 | ||
| Organism | Klebsiella pneumoniae strain hvKP859 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | NPJ86_RS22900 | Protein ID | WP_040225317.1 |
| Coordinates | 4696350..4696634 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | R4Y888 |
| Locus tag | NPJ86_RS22905 | Protein ID | WP_002886901.1 |
| Coordinates | 4696624..4696866 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NPJ86_RS22875 (NPJ86_22875) | 4691822..4692130 | - | 309 | WP_016947038.1 | PTS sugar transporter subunit IIB | - |
| NPJ86_RS22880 (NPJ86_22880) | 4692215..4692388 | + | 174 | WP_002886906.1 | hypothetical protein | - |
| NPJ86_RS22885 (NPJ86_22885) | 4692391..4693134 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
| NPJ86_RS22890 (NPJ86_22890) | 4693491..4695629 | + | 2139 | WP_004222153.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| NPJ86_RS22895 (NPJ86_22895) | 4695882..4696346 | + | 465 | WP_004178375.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| NPJ86_RS22900 (NPJ86_22900) | 4696350..4696634 | - | 285 | WP_040225317.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NPJ86_RS22905 (NPJ86_22905) | 4696624..4696866 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| NPJ86_RS22910 (NPJ86_22910) | 4696944..4698854 | - | 1911 | WP_009486549.1 | PRD domain-containing protein | - |
| NPJ86_RS22915 (NPJ86_22915) | 4698877..4700031 | - | 1155 | WP_002886900.1 | lactonase family protein | - |
| NPJ86_RS22920 (NPJ86_22920) | 4700098..4700838 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11172.02 Da Isoelectric Point: 10.3787
>T252729 WP_040225317.1 NZ_CP101790:c4696634-4696350 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNLRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNLRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|