Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3996065..3996684 Replicon chromosome
Accession NZ_CP101790
Organism Klebsiella pneumoniae strain hvKP859

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag NPJ86_RS19510 Protein ID WP_002892050.1
Coordinates 3996466..3996684 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag NPJ86_RS19505 Protein ID WP_002892066.1
Coordinates 3996065..3996439 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NPJ86_RS19495 (NPJ86_19495) 3991217..3992410 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
NPJ86_RS19500 (NPJ86_19500) 3992433..3995579 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
NPJ86_RS19505 (NPJ86_19505) 3996065..3996439 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
NPJ86_RS19510 (NPJ86_19510) 3996466..3996684 + 219 WP_002892050.1 HHA domain-containing protein Toxin
NPJ86_RS19515 (NPJ86_19515) 3996843..3997409 + 567 WP_002892030.1 maltose O-acetyltransferase -
NPJ86_RS19520 (NPJ86_19520) 3997381..3997521 - 141 WP_004147370.1 hypothetical protein -
NPJ86_RS19525 (NPJ86_19525) 3997542..3998012 + 471 WP_002892026.1 YlaC family protein -
NPJ86_RS19530 (NPJ86_19530) 3997987..3999438 - 1452 WP_073557971.1 PLP-dependent aminotransferase family protein -
NPJ86_RS19535 (NPJ86_19535) 3999539..4000237 + 699 WP_002892021.1 GNAT family protein -
NPJ86_RS19540 (NPJ86_19540) 4000234..4000374 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
NPJ86_RS19545 (NPJ86_19545) 4000374..4000637 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T252727 WP_002892050.1 NZ_CP101790:3996466-3996684 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT252727 WP_002892066.1 NZ_CP101790:3996065-3996439 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References