Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relB-parE/ParE-RHH |
Location | 7773..8353 | Replicon | plasmid unnamed3 |
Accession | NZ_CP101787 | ||
Organism | Klebsiella pneumoniae strain hvKP841 |
Toxin (Protein)
Gene name | parE | Uniprot ID | A0A8J3DTL7 |
Locus tag | NPJ85_RS28800 | Protein ID | WP_071177730.1 |
Coordinates | 7773..8087 (-) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A2X1PRM1 |
Locus tag | NPJ85_RS28805 | Protein ID | WP_000093040.1 |
Coordinates | 8075..8353 (-) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NPJ85_RS28775 (NPJ85_28775) | 3717..5681 | + | 1965 | WP_071177727.1 | TraM recognition domain-containing protein | - |
NPJ85_RS28780 (NPJ85_28780) | 5681..6412 | + | 732 | WP_071177728.1 | MobC family replication-relaxation protein | - |
NPJ85_RS28785 (NPJ85_28785) | 6419..6949 | + | 531 | WP_071177729.1 | hypothetical protein | - |
NPJ85_RS28790 (NPJ85_28790) | 6976..7155 | - | 180 | WP_000165970.1 | Rop family plasmid primer RNA-binding protein | - |
NPJ85_RS28795 (NPJ85_28795) | 7181..7609 | - | 429 | WP_001140599.1 | hypothetical protein | - |
NPJ85_RS28800 (NPJ85_28800) | 7773..8087 | - | 315 | WP_071177730.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NPJ85_RS28805 (NPJ85_28805) | 8075..8353 | - | 279 | WP_000093040.1 | CopG family ribbon-helix-helix protein | Antitoxin |
NPJ85_RS28810 (NPJ85_28810) | 8528..8893 | - | 366 | WP_072354022.1 | TonB family protein | - |
NPJ85_RS28815 (NPJ85_28815) | 8890..9261 | - | 372 | WP_001237044.1 | cell envelope integrity protein TolA | - |
NPJ85_RS28820 (NPJ85_28820) | 9535..9780 | - | 246 | WP_032440458.1 | hypothetical protein | - |
NPJ85_RS28825 (NPJ85_28825) | 10425..11912 | + | 1488 | WP_004178082.1 | group II intron reverse transcriptase/maturase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..11970 | 11970 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11805.73 Da Isoelectric Point: 9.8324
>T252716 WP_071177730.1 NZ_CP101787:c8087-7773 [Klebsiella pneumoniae]
MPQVTISALAQRDLQRLQDFLKTKNRLAARKGGEVIVRAIQQLKTLPDIGRPVPFLPLEYKELVIGFGDSGYVMLYRHDR
EMDQIVIVTVRHQKESGYPGADSL
MPQVTISALAQRDLQRLQDFLKTKNRLAARKGGEVIVRAIQQLKTLPDIGRPVPFLPLEYKELVIGFGDSGYVMLYRHDR
EMDQIVIVTVRHQKESGYPGADSL
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|