Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 108482..109152 | Replicon | plasmid unnamed2 |
| Accession | NZ_CP101786 | ||
| Organism | Klebsiella pneumoniae strain hvKP841 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | Q6U619 |
| Locus tag | NPJ85_RS28335 | Protein ID | WP_004213072.1 |
| Coordinates | 108482..108925 (-) | Length | 148 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | Q6U620 |
| Locus tag | NPJ85_RS28340 | Protein ID | WP_004213073.1 |
| Coordinates | 108922..109152 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NPJ85_RS28300 (NPJ85_28300) | 103893..104168 | + | 276 | WP_004213932.1 | carboxymuconolactone decarboxylase family protein | - |
| NPJ85_RS28305 (NPJ85_28305) | 104231..104722 | + | 492 | WP_011251327.1 | DM13 domain-containing protein | - |
| NPJ85_RS28310 (NPJ85_28310) | 104771..105691 | + | 921 | WP_004213934.1 | DUF1471 domain-containing protein | - |
| NPJ85_RS28315 (NPJ85_28315) | 105782..106185 | + | 404 | Protein_124 | GAF domain-containing protein | - |
| NPJ85_RS28320 (NPJ85_28320) | 106703..107338 | - | 636 | Protein_125 | mucoid phenotype regulator RmpA2 | - |
| NPJ85_RS28325 (NPJ85_28325) | 107755..108059 | + | 305 | Protein_126 | transposase | - |
| NPJ85_RS28330 (NPJ85_28330) | 108082..108333 | - | 252 | WP_186987481.1 | hypothetical protein | - |
| NPJ85_RS28335 (NPJ85_28335) | 108482..108925 | - | 444 | WP_004213072.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NPJ85_RS28340 (NPJ85_28340) | 108922..109152 | - | 231 | WP_004213073.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| NPJ85_RS28345 (NPJ85_28345) | 109760..110893 | + | 1134 | WP_004213075.1 | DUF3800 domain-containing protein | - |
| NPJ85_RS28350 (NPJ85_28350) | 110909..111202 | + | 294 | WP_004213076.1 | hypothetical protein | - |
| NPJ85_RS28355 (NPJ85_28355) | 111192..111398 | - | 207 | WP_004213077.1 | hypothetical protein | - |
| NPJ85_RS28360 (NPJ85_28360) | 111750..112040 | + | 291 | WP_004213078.1 | hypothetical protein | - |
| NPJ85_RS28365 (NPJ85_28365) | 112030..112929 | + | 900 | WP_004225022.1 | nucleotide-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | - | iroN / iucA / iucB / iucC / iucD / iutA / rmpA2 | 1..190034 | 190034 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 148 a.a. Molecular weight: 16006.74 Da Isoelectric Point: 9.3642
>T252715 WP_004213072.1 NZ_CP101786:c108925-108482 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS
Download Length: 444 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|