252715

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 108482..109152 Replicon plasmid unnamed2
Accession NZ_CP101786
Organism Klebsiella pneumoniae strain hvKP841

Toxin (Protein)


Gene name vagD Uniprot ID Q6U619
Locus tag NPJ85_RS28335 Protein ID WP_004213072.1
Coordinates 108482..108925 (-) Length 148 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q6U620
Locus tag NPJ85_RS28340 Protein ID WP_004213073.1
Coordinates 108922..109152 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NPJ85_RS28300 (NPJ85_28300) 103893..104168 + 276 WP_004213932.1 carboxymuconolactone decarboxylase family protein -
NPJ85_RS28305 (NPJ85_28305) 104231..104722 + 492 WP_011251327.1 DM13 domain-containing protein -
NPJ85_RS28310 (NPJ85_28310) 104771..105691 + 921 WP_004213934.1 DUF1471 domain-containing protein -
NPJ85_RS28315 (NPJ85_28315) 105782..106185 + 404 Protein_124 GAF domain-containing protein -
NPJ85_RS28320 (NPJ85_28320) 106703..107338 - 636 Protein_125 mucoid phenotype regulator RmpA2 -
NPJ85_RS28325 (NPJ85_28325) 107755..108059 + 305 Protein_126 transposase -
NPJ85_RS28330 (NPJ85_28330) 108082..108333 - 252 WP_186987481.1 hypothetical protein -
NPJ85_RS28335 (NPJ85_28335) 108482..108925 - 444 WP_004213072.1 type II toxin-antitoxin system VapC family toxin Toxin
NPJ85_RS28340 (NPJ85_28340) 108922..109152 - 231 WP_004213073.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
NPJ85_RS28345 (NPJ85_28345) 109760..110893 + 1134 WP_004213075.1 DUF3800 domain-containing protein -
NPJ85_RS28350 (NPJ85_28350) 110909..111202 + 294 WP_004213076.1 hypothetical protein -
NPJ85_RS28355 (NPJ85_28355) 111192..111398 - 207 WP_004213077.1 hypothetical protein -
NPJ85_RS28360 (NPJ85_28360) 111750..112040 + 291 WP_004213078.1 hypothetical protein -
NPJ85_RS28365 (NPJ85_28365) 112030..112929 + 900 WP_004225022.1 nucleotide-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - iroN / iucA / iucB / iucC / iucD / iutA / rmpA2 1..190034 190034


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 148 a.a.        Molecular weight: 16006.74 Da        Isoelectric Point: 9.3642

>T252715 WP_004213072.1 NZ_CP101786:c108925-108482 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS

Download         Length: 444 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8677.73 Da        Isoelectric Point: 4.4563

>AT252715 WP_004213073.1 NZ_CP101786:c109152-108922 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRAAPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q6U619

Antitoxin

Source ID Structure
AlphaFold DB Q6U620

References