Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 12323..12951 Replicon plasmid unnamed2
Accession NZ_CP101786
Organism Klebsiella pneumoniae strain hvKP841

Toxin (Protein)


Gene name vagD Uniprot ID D8L2J9
Locus tag NPJ85_RS27785 Protein ID WP_001044770.1
Coordinates 12535..12951 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID -
Locus tag NPJ85_RS27780 Protein ID WP_115209317.1
Coordinates 12323..12538 (+) Length 72 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NPJ85_RS27755 (NPJ85_27755) 8246..8413 - 168 Protein_12 IS1 family transposase -
NPJ85_RS27760 (NPJ85_27760) 8717..9646 + 930 WP_004213558.1 Rpn family recombination-promoting nuclease/putative transposase -
NPJ85_RS27765 (NPJ85_27765) 9791..10570 - 780 WP_004213560.1 site-specific integrase -
NPJ85_RS27770 (NPJ85_27770) 10567..11388 - 822 WP_004213562.1 hypothetical protein -
NPJ85_RS27775 (NPJ85_27775) 11933..12351 - 419 Protein_16 hypothetical protein -
NPJ85_RS27780 (NPJ85_27780) 12323..12538 + 216 WP_115209317.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
NPJ85_RS27785 (NPJ85_27785) 12535..12951 + 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin Toxin
NPJ85_RS27790 (NPJ85_27790) 13072..13774 + 703 Protein_19 IS1 family transposase -
NPJ85_RS27795 (NPJ85_27795) 13803..14075 + 273 Protein_20 transposase -
NPJ85_RS27800 (NPJ85_27800) 14357..15360 - 1004 Protein_21 IS110 family transposase -
NPJ85_RS27805 (NPJ85_27805) 15451..15885 - 435 WP_000405672.1 Cd(II)/Pb(II)-responsive transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - iroN / iucA / iucB / iucC / iucD / iutA / rmpA2 1..190034 190034
- inside IScluster/Tn - - 13130..38421 25291


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(2-43)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15106.52 Da        Isoelectric Point: 7.1084

>T252712 WP_001044770.1 NZ_CP101786:12535-12951 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 72 a.a.        Molecular weight: 8182.14 Da        Isoelectric Point: 4.3322

>AT252712 WP_115209317.1 NZ_CP101786:12323-12538 [Klebsiella pneumoniae]
IFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQFEKADPDFMAEREDVVSDEGRFNL

Download         Length: 216 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GYM2

Antitoxin

Source ID Structure

References