Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 12323..12951 | Replicon | plasmid unnamed2 |
Accession | NZ_CP101786 | ||
Organism | Klebsiella pneumoniae strain hvKP841 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | D8L2J9 |
Locus tag | NPJ85_RS27785 | Protein ID | WP_001044770.1 |
Coordinates | 12535..12951 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | - |
Locus tag | NPJ85_RS27780 | Protein ID | WP_115209317.1 |
Coordinates | 12323..12538 (+) | Length | 72 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NPJ85_RS27755 (NPJ85_27755) | 8246..8413 | - | 168 | Protein_12 | IS1 family transposase | - |
NPJ85_RS27760 (NPJ85_27760) | 8717..9646 | + | 930 | WP_004213558.1 | Rpn family recombination-promoting nuclease/putative transposase | - |
NPJ85_RS27765 (NPJ85_27765) | 9791..10570 | - | 780 | WP_004213560.1 | site-specific integrase | - |
NPJ85_RS27770 (NPJ85_27770) | 10567..11388 | - | 822 | WP_004213562.1 | hypothetical protein | - |
NPJ85_RS27775 (NPJ85_27775) | 11933..12351 | - | 419 | Protein_16 | hypothetical protein | - |
NPJ85_RS27780 (NPJ85_27780) | 12323..12538 | + | 216 | WP_115209317.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
NPJ85_RS27785 (NPJ85_27785) | 12535..12951 | + | 417 | WP_001044770.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NPJ85_RS27790 (NPJ85_27790) | 13072..13774 | + | 703 | Protein_19 | IS1 family transposase | - |
NPJ85_RS27795 (NPJ85_27795) | 13803..14075 | + | 273 | Protein_20 | transposase | - |
NPJ85_RS27800 (NPJ85_27800) | 14357..15360 | - | 1004 | Protein_21 | IS110 family transposase | - |
NPJ85_RS27805 (NPJ85_27805) | 15451..15885 | - | 435 | WP_000405672.1 | Cd(II)/Pb(II)-responsive transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | - | iroN / iucA / iucB / iucC / iucD / iutA / rmpA2 | 1..190034 | 190034 | |
- | inside | IScluster/Tn | - | - | 13130..38421 | 25291 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15106.52 Da Isoelectric Point: 7.1084
>T252712 WP_001044770.1 NZ_CP101786:12535-12951 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|