Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4156884..4157503 Replicon chromosome
Accession NZ_CP101784
Organism Klebsiella pneumoniae strain hvKP841

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag NPJ85_RS20670 Protein ID WP_002892050.1
Coordinates 4157285..4157503 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag NPJ85_RS20665 Protein ID WP_002892066.1
Coordinates 4156884..4157258 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NPJ85_RS20655 (NPJ85_20655) 4152036..4153229 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
NPJ85_RS20660 (NPJ85_20660) 4153252..4156398 + 3147 WP_020326861.1 multidrug efflux RND transporter permease subunit AcrB -
NPJ85_RS20665 (NPJ85_20665) 4156884..4157258 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
NPJ85_RS20670 (NPJ85_20670) 4157285..4157503 + 219 WP_002892050.1 HHA domain-containing protein Toxin
NPJ85_RS20675 (NPJ85_20675) 4157662..4158228 + 567 WP_002892030.1 maltose O-acetyltransferase -
NPJ85_RS20680 (NPJ85_20680) 4158200..4158340 - 141 WP_004147370.1 hypothetical protein -
NPJ85_RS20685 (NPJ85_20685) 4158361..4158831 + 471 WP_002892026.1 YlaC family protein -
NPJ85_RS20690 (NPJ85_20690) 4158806..4160257 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
NPJ85_RS20695 (NPJ85_20695) 4160358..4161056 + 699 WP_002892021.1 GNAT family protein -
NPJ85_RS20700 (NPJ85_20700) 4161053..4161193 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
NPJ85_RS20705 (NPJ85_20705) 4161193..4161456 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T252702 WP_002892050.1 NZ_CP101784:4157285-4157503 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT252702 WP_002892066.1 NZ_CP101784:4156884-4157258 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References