Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicB(antitoxin) |
| Location | 3341004..3341635 | Replicon | chromosome |
| Accession | NZ_CP101784 | ||
| Organism | Klebsiella pneumoniae strain hvKP841 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A1Q8YTV3 |
| Locus tag | NPJ85_RS16750 | Protein ID | WP_012542177.1 |
| Coordinates | 3341459..3341635 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A3Q9U6R4 |
| Locus tag | NPJ85_RS16745 | Protein ID | WP_017898984.1 |
| Coordinates | 3341004..3341411 (-) | Length | 136 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NPJ85_RS16710 (NPJ85_16710) | 3336368..3336802 | - | 435 | WP_012542168.1 | phage terminase small subunit P27 family | - |
| NPJ85_RS16715 (NPJ85_16715) | 3337050..3337481 | - | 432 | WP_023279521.1 | hypothetical protein | - |
| NPJ85_RS16720 (NPJ85_16720) | 3337478..3337795 | - | 318 | WP_023279522.1 | hypothetical protein | - |
| NPJ85_RS16725 (NPJ85_16725) | 3337747..3338109 | - | 363 | WP_014228901.1 | HNH endonuclease | - |
| NPJ85_RS16730 (NPJ85_16730) | 3339234..3339584 | - | 351 | WP_017898986.1 | hypothetical protein | - |
| NPJ85_RS16735 (NPJ85_16735) | 3339581..3340078 | - | 498 | WP_023279523.1 | lysozyme | - |
| NPJ85_RS16740 (NPJ85_16740) | 3340078..3340293 | - | 216 | WP_017880269.1 | class II holin family protein | - |
| NPJ85_RS16745 (NPJ85_16745) | 3341004..3341411 | - | 408 | WP_017898984.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| NPJ85_RS16750 (NPJ85_16750) | 3341459..3341635 | - | 177 | WP_012542177.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| NPJ85_RS16755 (NPJ85_16755) | 3341999..3343783 | + | 1785 | WP_032415155.1 | ATP-binding protein | - |
| NPJ85_RS16760 (NPJ85_16760) | 3343803..3344837 | + | 1035 | WP_219071718.1 | DNA cytosine methyltransferase | - |
| NPJ85_RS16765 (NPJ85_16765) | 3344862..3345203 | - | 342 | WP_017898982.1 | antiterminator Q family protein | - |
| NPJ85_RS16770 (NPJ85_16770) | 3345216..3346247 | - | 1032 | WP_071058942.1 | DUF968 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 3307535..3365046 | 57511 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6632.83 Da Isoelectric Point: 11.0174
>T252701 WP_012542177.1 NZ_CP101784:c3341635-3341459 [Klebsiella pneumoniae]
VKQSELRRWLAAQGAEFKDGTNHLKIYLNGKQTVMPRHPGKEIPEPLRKAILKQLGIK
VKQSELRRWLAAQGAEFKDGTNHLKIYLNGKQTVMPRHPGKEIPEPLRKAILKQLGIK
Download Length: 177 bp
Antitoxin
Download Length: 136 a.a. Molecular weight: 14959.96 Da Isoelectric Point: 4.4277
>AT252701 WP_017898984.1 NZ_CP101784:c3341411-3341004 [Klebsiella pneumoniae]
MRYPVIFEHDETGWAVFFPDIPEAMTGGETREEALEMAQDALVTAFDFYFDDRREIPAPSAEGDAFVEVPASVAAKVLLL
NRLVSTNTSNADLARLINTRPQEVQRIVSLGHSTKIDTIQKALSALGQKMEIVVH
MRYPVIFEHDETGWAVFFPDIPEAMTGGETREEALEMAQDALVTAFDFYFDDRREIPAPSAEGDAFVEVPASVAAKVLLL
NRLVSTNTSNADLARLINTRPQEVQRIVSLGHSTKIDTIQKALSALGQKMEIVVH
Download Length: 408 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1Q8YTV3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3Q9U6R4 |